BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0103 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 2.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 4.8 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 8.4 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = +3 Query: 276 EVSPIPTTSTSAPVQK-----KYQVK-LNVYGWDQSDKFVKVFVELKNVH--TLPKEQVY 431 +VSP+P TSA V+ +Y+ + + + ++ +K+ KV + + +++ T +E Y Sbjct: 301 KVSPVPADDTSAYVESVVVDYRYRGRGIGTHLMEEVEKYCKVMMNINHMYIATDGQEVFY 360 Query: 432 CKL 440 KL Sbjct: 361 AKL 363 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.6 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +3 Query: 456 ELHVDNLENKDYLLVINKLLEPINVADSHWKQKTDKVVIFLAKSNPNTTWSHMTEIEKKF 635 +LH ++N Y+L + + P+N + + KQK+ K + ++ + E+++KF Sbjct: 972 KLHY-KVQNNKYVLKLKSMKGPLNNSLTEQKQKSYKQIDASGEAVEKKA-QYKKEVDEKF 1029 Query: 636 EDQ 644 ++ Sbjct: 1030 AEE 1032 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +3 Query: 90 IQEVLITHHYIQ*INIRSDIEEINDLLKQAKRKKVQDLL 206 + E+ + H Y +++ D N L + + + QDLL Sbjct: 782 VHELGLAHKYFTYLSVHGDKTRYNIALAETEANQCQDLL 820 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 369 KFVKVFVELKNVHTLPKEQVYCKLTDKSMELHVD 470 K VKV+VE + +L ++ L D+ EL D Sbjct: 161 KTVKVYVEQMDAVSLEFMEIMANLRDEKNELPAD 194 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,870 Number of Sequences: 2352 Number of extensions: 12472 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -