BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0102 (583 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18H10.03 |tif35||translation initiation factor eIF3g|Schizos... 26 4.6 SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosa... 25 8.1 >SPBC18H10.03 |tif35||translation initiation factor eIF3g|Schizosaccharomyces pombe|chr 2|||Manual Length = 282 Score = 25.8 bits (54), Expect = 4.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 570 GHKHYRNITVGHSTNKVGKHCYRRIQEAWTTIFEE 466 G + +N V T VG++ R+Q WTT EE Sbjct: 75 GKEAGKNSGVDARTTSVGENVQLRLQLGWTTTKEE 109 >SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 25.0 bits (52), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 87 GKTMVTINHKLNYICFFPRAE--FLQPGDPL 1 GKT + LNY +FP ++ FL P PL Sbjct: 136 GKTFIAAVVMLNYFRWFPESKIIFLAPTKPL 166 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,399,711 Number of Sequences: 5004 Number of extensions: 47382 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -