Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0102
         (583 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1015 + 33819203-33821827                                         27   8.2  

>01_06_1015 + 33819203-33821827
          Length = 874

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = -3

Query: 383 CSPKQILKLLRKACLFYLDKHYYKAIRHEIFKES 282
           C  K+IL +L K C+ Y+D + +  + H++ +E+
Sbjct: 201 CIGKEILDVLLKRCMLYMDGNDHVRM-HDVIRET 233


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,752,705
Number of Sequences: 37544
Number of extensions: 268030
Number of successful extensions: 538
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 527
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 538
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1364465340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)