BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0101 (523 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B... 27 1.7 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 27 2.2 SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 25 5.2 SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 25 6.8 SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosacch... 25 9.0 SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pomb... 25 9.0 >SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 Brl1|Schizosaccharomyces pombe|chr 3|||Manual Length = 692 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -1 Query: 247 SQKKVKFGNFEFFNMLSFL*LKGVKN-RIAILKKKKSHLCIW 125 +++++++ N FF+ + L L + N R+AIL+ + LCIW Sbjct: 369 AKQQMQYTNNLFFDDMMLL-LSNLSNARVAILEGYSNRLCIW 409 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 26.6 bits (56), Expect = 2.2 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 138 WLFFFLSMAILFFTPFN*RKDNILKNSKLPNLTFFCELPFAIRE 269 WLF FL+ A++ N +L + +P++TFFC L + E Sbjct: 108 WLFKFLASALVLLLRPNYTMFPML--NVVPSITFFCSLVCLLAE 149 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 175 KNRIAILKKKKSHLCIWKILVI 110 KN I+ KKKKS L +W +L + Sbjct: 226 KNWISHAKKKKSSLYMWGVLFL 247 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 357 VPINLFKLNKLTLTILF*LYFVLT 286 VP+N F++N++ +LF LY V T Sbjct: 708 VPLNRFRVNRVLGLLLFILYIVGT 731 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 25.0 bits (52), Expect = 6.8 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 6/51 (11%) Frame = -1 Query: 232 KFGNFEFFNMLSF----L*LKGVKNRIAILKKKKSHLCIW--KILVIFFYL 98 KF FF LSF L L +K + + SHLCIW KIL+ Y+ Sbjct: 667 KFTESYFFLSLSFRDPILVLSTMKPYLCNITFLGSHLCIWQPKILLGIMYV 717 >SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1935 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 454 DNKEWYLKELFWFQFC 407 DN E+ LK+L W Q C Sbjct: 63 DNNEFALKDLTWLQNC 78 >SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 392 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 85 CLYISNKKK*LIFSKYISGSFFF*VWQFYFLHLLIKEKITY 207 CL KK + F ++SG+FF V + L + K + Y Sbjct: 336 CLLNYEKKFHVAFDAHVSGTFFGVVSSLFLLPAMWKRRSLY 376 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,092,981 Number of Sequences: 5004 Number of extensions: 41518 Number of successful extensions: 89 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -