BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0101 (523 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075480-1|ABF85763.1| 157|Drosophila melanogaster RE38359p pro... 29 5.1 AY089442-1|AAL90180.1| 459|Drosophila melanogaster AT26079p pro... 28 6.7 AE014134-1987|AAF53031.3| 459|Drosophila melanogaster CG7309-PA... 28 6.7 >AY075480-1|ABF85763.1| 157|Drosophila melanogaster RE38359p protein. Length = 157 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 235 VKFGNFEFFNMLSFL*LKGVKNRIAILKKKK 143 +KFG+ EF N ++L +K +K R KKKK Sbjct: 127 IKFGSLEFKNNQTYLHIKRIKCRKCREKKKK 157 >AY089442-1|AAL90180.1| 459|Drosophila melanogaster AT26079p protein. Length = 459 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -2 Query: 354 PINLFKLNKLTLTILF*LYFVLTRKTAMLREWQKVIRKKRSNLAISSFLICYLFF 190 P ++ + L+L +L L V TRK + W + K S L+++ + LFF Sbjct: 231 PWGIYPILALSLILLMFL-LVATRKPRIFTGWDSINYKAESGLSVAGIGMSILFF 284 >AE014134-1987|AAF53031.3| 459|Drosophila melanogaster CG7309-PA protein. Length = 459 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -2 Query: 354 PINLFKLNKLTLTILF*LYFVLTRKTAMLREWQKVIRKKRSNLAISSFLICYLFF 190 P ++ + L+L +L L V TRK + W + K S L+++ + LFF Sbjct: 231 PWGIYPILALSLILLMFL-LVATRKPRIFTGWDSINYKAESGLSVAGIGMSILFF 284 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,180,862 Number of Sequences: 53049 Number of extensions: 363020 Number of successful extensions: 683 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -