BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0101 (523 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 27 0.12 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 27 0.12 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 27 0.12 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.4 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 27.1 bits (57), Expect = 0.12 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 385 ISDGIARNKIETRIILLDTILCCHGCNNS 471 I D I N++E RII T+ C HG +S Sbjct: 16 IRDRIGDNELEERIIYPGTLWCGHGNKSS 44 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 27.1 bits (57), Expect = 0.12 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 385 ISDGIARNKIETRIILLDTILCCHGCNNS 471 I D I N++E RII T+ C HG +S Sbjct: 21 IRDRIGDNELEERIIYPGTLWCGHGNKSS 49 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 27.1 bits (57), Expect = 0.12 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 385 ISDGIARNKIETRIILLDTILCCHGCNNS 471 I D I N++E RII T+ C HG +S Sbjct: 21 IRDRIGDNELEERIIYPGTLWCGHGNKSS 49 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -2 Query: 279 TAMLREWQKVIRKKRSNLAISSFLICYLFF 190 TA + EW +++R KR L I+ ++C++ + Sbjct: 401 TAAVDEWPRLLR-KRKELFIA--IVCFVSY 427 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -2 Query: 279 TAMLREWQKVIRKKRSNLAISSFLICYLFF 190 TA + EW +++R KR L I+ ++C++ + Sbjct: 454 TAAVDEWPRLLR-KRKELFIA--IVCFVSY 480 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,113 Number of Sequences: 438 Number of extensions: 3004 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -