BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0100 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 199 1e-51 SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) 116 1e-26 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 95 5e-20 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 73 1e-13 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 67 1e-11 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 42 3e-04 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 39 0.003 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 36 0.025 SB_30757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) 31 0.55 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 31 0.55 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 1.7 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 1.7 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 29 2.2 SB_20265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12803| Best HMM Match : Lig_chan (HMM E-Value=0) 29 3.9 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 28 5.1 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 27 8.9 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 199 bits (486), Expect = 1e-51 Identities = 107/154 (69%), Positives = 117/154 (75%) Frame = +3 Query: 144 LQLIVAEKSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVH 323 ++L+V EK +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVH Sbjct: 82 VKLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVH 141 Query: 324 PEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEM 503 PEGKFVVD+DK +D+ + VDPLVSLMMVEKVPDSTYEM Sbjct: 142 PEGKFVVDIDKGIDMAE-----------------------VDPLVSLMMVEKVPDSTYEM 178 Query: 504 VGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 VGGLDKQIKEIKEVIELPVKHPELF+ALGI QPK Sbjct: 179 VGGLDKQIKEIKEVIELPVKHPELFEALGIDQPK 212 >SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) Length = 158 Score = 116 bits (279), Expect = 1e-26 Identities = 55/75 (73%), Positives = 63/75 (84%) Frame = +3 Query: 144 LQLIVAEKSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVH 323 ++L+V EK +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVH Sbjct: 82 VKLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVH 141 Query: 324 PEGKFVVDLDKNVDI 368 PEGKFVVD+DK +D+ Sbjct: 142 PEGKFVVDIDKGIDM 156 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 94.7 bits (225), Expect = 5e-20 Identities = 50/115 (43%), Positives = 72/115 (62%) Frame = +3 Query: 261 GSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPN 440 G VGEV+K + ++K +VK ++VV + VD + RVAL + T+ + LP Sbjct: 56 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPR 115 Query: 441 KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 +VDPLV M E + +Y VGGL +QI+E++EVIELP+ +PELF +GIA PK Sbjct: 116 EVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPK 170 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 87.0 bits (206), Expect = 1e-17 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 3/163 (1%) Frame = +3 Query: 126 ITKIEELQLIVAEKSQNLRRLQAQRN---ELNAKVRMLRXXXXXXXXXGSYVGEVVKPMD 296 + +I++ L+ E QN RL+ Q E +KV LR VG + + +D Sbjct: 260 LDRIKDFLLMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMS-------VGNLEEIID 312 Query: 297 KKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVE 476 +V + V + VD + + C V L ++ + + +L + DP+V++M +E Sbjct: 313 DNHAIVSTSVGSEHYVSILSFVDKDLLEPGCTVLLNHKVHAVVGVLSDDADPMVTVMKLE 372 Query: 477 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 K P +Y +GGLD QI+EIKE +ELP+ HPEL++ +GI PK Sbjct: 373 KAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPPK 415 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 73.3 bits (172), Expect = 1e-13 Identities = 34/68 (50%), Positives = 47/68 (69%) Frame = +3 Query: 402 RNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFD 581 RN+ Y +H LP K+DP V++M VE+ PD TY +GG +QI +++EV+E P+ HPE F Sbjct: 53 RNK-YQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFV 111 Query: 582 ALGIAQPK 605 LGI PK Sbjct: 112 NLGIEPPK 119 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/112 (29%), Positives = 62/112 (55%) Frame = +3 Query: 270 VGEVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVD 449 +G+ ++ +D+ +V + V + +D + + VAL S L ILP + D Sbjct: 88 IGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEAD 147 Query: 450 PLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 ++++ E+ P+ +Y +GG+D Q +EI+E +ELP+ H EL+ +GI P+ Sbjct: 148 SSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPR 199 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 44.8 bits (101), Expect = 5e-05 Identities = 16/38 (42%), Positives = 29/38 (76%) Frame = +3 Query: 492 TYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 +++ +GGL QI+ ++E+IE+P+ +PELF A G+ P+ Sbjct: 254 SFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPR 291 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +3 Query: 477 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 +VP + VGG + +++KE +E P+KHPE F LGI P+ Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPR 572 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +3 Query: 477 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDA 584 K+PD +++ VGGLD +EI + I+LP+ HPELF A Sbjct: 805 KIPDISWKDVGGLDSVKEEILDTIQLPLLHPELFAA 840 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = +3 Query: 495 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 ++ VGGL+KQI+ +KE+I P+ +PE+FD I P+ Sbjct: 883 FDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPR 919 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 41.9 bits (94), Expect = 4e-04 Identities = 26/80 (32%), Positives = 42/80 (52%) Frame = +3 Query: 366 INDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEV 545 I DVT+ + N +Y ++ K + + + V DS ++ GLD IK +KE+ Sbjct: 174 IEDVTS----VIDNNAYV---VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKEL 226 Query: 546 IELPVKHPELFDALGIAQPK 605 ++ P+ +PE F LGI PK Sbjct: 227 VQFPLYYPESFSHLGINGPK 246 Score = 35.9 bits (79), Expect = 0.025 Identities = 14/45 (31%), Positives = 29/45 (64%) Frame = +3 Query: 471 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+ Sbjct: 475 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPR 519 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 4e-04 Identities = 26/80 (32%), Positives = 42/80 (52%) Frame = +3 Query: 366 INDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEV 545 I DVT+ + N +Y ++ K + + + V DS ++ GLD IK +KE+ Sbjct: 4 IEDVTS----VIDNNAYV---VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKEL 56 Query: 546 IELPVKHPELFDALGIAQPK 605 ++ P+ +PE F LGI PK Sbjct: 57 VQFPLYYPESFSHLGINGPK 76 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/79 (27%), Positives = 41/79 (51%) Frame = +3 Query: 300 KKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEK 479 K ++K + + + V+ ++T V + +SY + + LP + D V M V++ Sbjct: 88 KCAVIKTSTRQTYFLPVIGLVEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDE 147 Query: 480 VPDSTYEMVGGLDKQIKEI 536 P Y +GGLD+QI+E+ Sbjct: 148 RPTEQYSDIGGLDQQIQEM 166 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/45 (33%), Positives = 31/45 (68%) Frame = +3 Query: 471 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 V +VP+ +++ +GGL+ +E++E+++ PV+HP+ F G+ K Sbjct: 301 VVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSK 345 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 35.9 bits (79), Expect = 0.025 Identities = 14/45 (31%), Positives = 29/45 (64%) Frame = +3 Query: 471 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPK 605 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+ Sbjct: 4 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPR 48 >SB_30757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 374 CHGQLSCRSSQRKLYLTQNTTQQSRSSCV 460 CH LSC SQR L Q Q+SR CV Sbjct: 114 CHVGLSCLKSQRTLRALQKALQRSRVECV 142 >SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) Length = 201 Score = 31.5 bits (68), Expect = 0.55 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +3 Query: 333 KFVVDLDKNV---DINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEM 503 K ++D D V DIN+ T N + L +E+Y+ H++L K D + S +E T ++ Sbjct: 23 KALLDRDGKVCMLDINEKTGNETLKLLSENYSKHRVLFIKCD-VTSQPQMEAAFQRTKDV 81 Query: 504 VGGLD 518 G LD Sbjct: 82 FGRLD 86 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +3 Query: 453 LVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF 578 L S +++EK P+ + + GL+ + +KE + LP+K P LF Sbjct: 83 LNSAIVMEK-PNVKWSDIAGLESAKEALKEAVILPIKFPHLF 123 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILPNKVDPL 455 DI ++ C+VA E +TL + LPN +D L Sbjct: 154 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 184 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILPNKVDPL 455 DI ++ C+VA E +TL + LPN +D L Sbjct: 525 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 555 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILPNKVDPL 455 DI ++ C+VA E +TL + LPN +D L Sbjct: 89 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 119 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 351 DKNVDINDVTANCRVALRNESYTLHKILPNKVDPL 455 D N+ + + +CR A+ E+++ H PN VDPL Sbjct: 215 DCNLQLTCLQPSCRYAVLVEAFSSHPNDPNAVDPL 249 >SB_20265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/52 (21%), Positives = 27/52 (51%) Frame = +3 Query: 372 DVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQI 527 D+ + L + LHK++PN V+ + + ++ D ++ ++G D ++ Sbjct: 463 DLVKKAQTTLATANLRLHKVVPNSVEVMEAFPAEDRAKDISWGVLGPRDGRV 514 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 348 LDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVP 485 +D+N + + N +L L ++PN VD + M++KVP Sbjct: 952 IDENFKVWLIEINVNPSLSTSCQVLKDLMPNMVDNTIRPEMIQKVP 997 >SB_833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +3 Query: 42 HESQ*RNMTLTTKMEVDTVKGEGFRPYYITKIEELQLIVAEKSQNLRRLQ 191 HE+Q R + LT E KG+ F KI+ELQ V + +Q ++ L+ Sbjct: 123 HEAQRREVVLTKDYERAVEKGDNF----YAKIDELQEKVDDTTQKIKLLE 168 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILP---NKVDP 452 DI + C+VA E +TL++ILP K+DP Sbjct: 1274 DIRPIALTCQVAKVMEGFTLNRILPPIMRKLDP 1306 >SB_12803| Best HMM Match : Lig_chan (HMM E-Value=0) Length = 1001 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -2 Query: 461 RHKRIDFVG*YFV*GIAFVAKSDTTIGRDIVNINVLV 351 R + IDF Y GI +A++DTT+G +VN++ ++ Sbjct: 390 RSRVIDFSSPYGEVGIGILARTDTTLG-SVVNMDFMI 425 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +3 Query: 276 EVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPL 455 + V P+ K + VHP K D+ ++ C++A E +TL ++LP+ ++ L Sbjct: 309 DFVPPLLKSAI---VHPISKQTPPKSIKDDLRPISLTCQMAKICEGFTLIRVLPSVLEQL 365 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/51 (27%), Positives = 30/51 (58%) Frame = +3 Query: 420 LHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPE 572 L+K+L ++ S+ +E+ + + V GL+K+IK++++ EL K + Sbjct: 511 LNKVLERNMELESSVSAMERKNKALEKSVNGLEKEIKKMEQNYELKSKESD 561 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILPNKVDPL 455 DI ++ C+VA E TL + LPN +D L Sbjct: 473 DIRPISLTCQVAKLMEGLTLSRALPNILDRL 503 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 134 LGYVVRAKTLTLHRVHFHFSRESHI 60 LG + RA+T+ LHR SRE H+ Sbjct: 118 LGELERAQTVLLHRASSRHSREEHV 142 >SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILPNKVDPL 455 DI ++ C+VA E TL + LPN +D L Sbjct: 511 DIRPISLTCQVAKLMEGLTLSRALPNILDRL 541 >SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1837 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +3 Query: 363 DINDVTANCRVALRNESYTLHKILP---NKVDP 452 DI + C+VA E +TL +ILP K+DP Sbjct: 1491 DIRPIALTCQVAKVMEGFTLSRILPPIMRKLDP 1523 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 555 PVKHPELFDALGIAQP 602 PV+HPE F ALG+ P Sbjct: 2 PVQHPEEFSALGLTHP 17 >SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 437 QQSRSSCVA--HDGRESAGLYLRNGRWSRQTNQGDQRG 544 Q+S++S + GR G YL +G SRQ ++ +QRG Sbjct: 856 QKSQASSLPKIEHGRSLVGNYLSDGENSRQEHRDEQRG 893 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 555 PVKHPELFDALGIAQP 602 PV+HPE F ALG+ P Sbjct: 2 PVQHPEEFSALGLTHP 17 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,324,916 Number of Sequences: 59808 Number of extensions: 322205 Number of successful extensions: 855 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -