BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0094 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0621 + 25587476-25587604,25588230-25588423,25588800-255888... 27 9.5 04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-70... 27 9.5 >11_06_0621 + 25587476-25587604,25588230-25588423,25588800-25588874, 25589434-25591852 Length = 938 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 490 CKLILYMF*PCAVNSCEFSVLSANVLVKFNC 582 C +I P ++SC FSVL+A+ V+ +C Sbjct: 130 CFIIHLRIPPLGLSSCPFSVLTASASVQSDC 160 >04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-707693, 707766-708145,708508-708601,709351-709475,709633-709674, 710822-710892,710979-711060,711157-711277,712404-712713 Length = 544 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 503 YICFNLVPLTHASSVCLVRMYLLNSTVTTR 592 Y+C + + ASS+ ++RMY L+S +TTR Sbjct: 254 YVCSTYLG-SAASSIDIIRMYNLSSDMTTR 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,404,321 Number of Sequences: 37544 Number of extensions: 248090 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -