BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0094 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 1.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 1.9 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 4.4 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 144 YTNFYIMYPGKL 179 Y N+YI +PGK+ Sbjct: 142 YNNYYIWHPGKI 153 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 144 YTNFYIMYPGKL 179 Y N+YI +PGK+ Sbjct: 142 YNNYYIWHPGKI 153 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 189 ICTYSILVSGVRLILLSKGYVRMVTVAFPTSNIHFL 296 I T+ + V +ILL GYV + + P +NI+ + Sbjct: 48 IPTWLSFIRIVLVILLRAGYVLIHIGSVPVNNINLI 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,262 Number of Sequences: 438 Number of extensions: 3116 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -