Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0094
         (639 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   1.9  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   1.9  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    22   4.4  

>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 144 YTNFYIMYPGKL 179
           Y N+YI +PGK+
Sbjct: 142 YNNYYIWHPGKI 153


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 144 YTNFYIMYPGKL 179
           Y N+YI +PGK+
Sbjct: 142 YNNYYIWHPGKI 153


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 189 ICTYSILVSGVRLILLSKGYVRMVTVAFPTSNIHFL 296
           I T+   +  V +ILL  GYV +   + P +NI+ +
Sbjct: 48  IPTWLSFIRIVLVILLRAGYVLIHIGSVPVNNINLI 83


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,262
Number of Sequences: 438
Number of extensions: 3116
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19193721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)