BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0088 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 33 0.012 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 33 0.012 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 31 0.037 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 31 0.037 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 31 0.037 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 31 0.037 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 31 0.037 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.11 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.11 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.11 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.11 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.11 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 2.4 AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 25 3.2 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 3.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.2 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.4 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.7 DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 23 9.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.7 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 9.7 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.7 bits (71), Expect = 0.012 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 246 AEERFKEVAEAYEVLSDKKKREIYDAH 326 AE RF E+ ++YE+LSD ++R +D + Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.7 bits (71), Expect = 0.012 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 246 AEERFKEVAEAYEVLSDKKKREIYDAH 326 AE RF E+ ++YE+LSD ++R +D + Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.1 bits (67), Expect = 0.037 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKREIYDAH 326 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.11 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 255 RFKEVAEAYEVLSDKKKREIYDAH 326 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.0 bits (52), Expect = 2.4 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -1 Query: 528 DPYPHPCR 505 +PYPHPCR Sbjct: 334 EPYPHPCR 341 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 24.6 bits (51), Expect = 3.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 180 DIKKAYRKLALKYHPDKNKAAGAEERFKEVAEAYEVL 290 DI R + YHP G E FK+V +A VL Sbjct: 107 DIGTLMRSVTTYYHPILMGGEGKLEDFKKVQDAVGVL 143 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 3.2 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -3 Query: 577 PPGPPGRACPMLMLLKGSISTSMSRSKNVVVPPPFRSKNSWNG 449 P G PGR C G + S+S V V P K W+G Sbjct: 786 PKGEPGRDCEAAPYYTGILLVRHSQSDEVPVCEPGHLK-LWDG 827 Score = 24.2 bits (50), Expect = 4.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 586 RKAPPGPPG 560 RK PPGPPG Sbjct: 714 RKGPPGPPG 722 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 564 GGPGGAFRSHSFNFHGSPSRKEKTQDPPIEHD 659 G PGG + NF+ P +T PP +D Sbjct: 307 GAPGGPPQGMRPNFYNRPMGDPQTSRPPSGND 338 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 474 SDRRIPGTGWPNQRTARTL 418 S RRIP W +QRT + Sbjct: 221 SSRRIPAVVWRHQRTGAVI 239 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 474 SDRRIPGTGWPNQRTARTL 418 S RRIP W +QRT + Sbjct: 221 SSRRIPAVVWRHQRTGAVI 239 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 131 AHFDLYCIRETLILDNLSTIYEILANNH 48 A FDL + ET ++DN+ + +L NN+ Sbjct: 104 ADFDLIALTETWLVDNIPS--ALLFNNN 129 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 573 GGAFRSHSFNFHGSPSRKEKTQD 641 G AFR++ + HG+ +RK D Sbjct: 83 GNAFRNYYESIHGAITRKSTLND 105 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 195 YRKLALKYHPDKNKAAGAEERFKEVAEAYEVLSDKKKREI 314 +++ +KY+P K + E V A+E LS +++ ++ Sbjct: 514 FKQATIKYYPSKERWEMTMEDRTFVYGAWENLSKRREEDV 553 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 249 EERFKEVAEAYEVLSDKKKR 308 EE++KEV +V+ D KK+ Sbjct: 993 EEQYKEVMRRKKVVEDDKKK 1012 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 789,737 Number of Sequences: 2352 Number of extensions: 16773 Number of successful extensions: 88 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -