BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0084 (746 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1002 + 25176434-25176501,25176613-25176859,25178106-251781... 30 1.7 12_02_1015 + 25331667-25332169,25333305-25333406,25333775-253339... 28 9.1 >12_02_1002 + 25176434-25176501,25176613-25176859,25178106-25178171, 25178754-25178822,25179007-25179080,25180850-25180991, 25181546-25181596,25181769-25181774 Length = 240 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 259 LFQRLCKFNSNIFELEQFIIDLNK-NKPDSNLAKTKGYLKSI 381 + +R CK N N+ L+Q + +K N S L KT Y+KS+ Sbjct: 104 VMKRRCKINENLKTLQQLVPVCDKSNNQASTLDKTIRYMKSL 145 >12_02_1015 + 25331667-25332169,25333305-25333406,25333775-25333919, 25334002-25334186,25334297-25334401,25334507-25334604, 25334686-25334924,25335030-25335123,25335190-25335275, 25335579-25335677,25335804-25335869 Length = 573 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -1 Query: 329 LFKSIINCSNSNILELNLHSL*NKSTKLYCRIQDGVFLMMSRLNRLSV 186 L KS+INC N N L L N ST L + D + S L L + Sbjct: 247 LSKSVINCPNLNELSLGFTQQNNDSTDL-ISLMDSLGRTCSNLRNLHI 293 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,199,171 Number of Sequences: 37544 Number of extensions: 274794 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -