BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0075 (473 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0378 - 24822436-24822521,24822623-24822738,24823010-248230... 34 0.051 10_06_0010 + 9574265-9574524,9574629-9574956,9576663-9576788,957... 33 0.12 07_03_0179 + 14801037-14801108,14801325-14802788 30 1.1 01_05_0199 - 19174971-19175105,19176302-19176628,19176813-191769... 29 1.4 11_04_0097 + 13448740-13450725 29 1.9 02_04_0431 - 22841708-22842571,22842659-22842743,22842796-228428... 29 1.9 05_07_0216 + 28461783-28461788,28461837-28462295,28463198-284633... 29 2.5 05_04_0209 - 19073147-19074041,19074117-19074163,19074258-190744... 29 2.5 08_02_0531 + 18256597-18256836,18257637-18257735,18258038-182581... 28 3.3 05_07_0247 + 28643862-28644310,28645151-28645207,28645644-286489... 28 3.3 05_05_0134 + 22619297-22619801,22619879-22621960,22622067-22623718 28 3.3 04_04_0871 + 28898262-28898534,28899552-28900015,28900242-289003... 28 4.4 01_06_1446 - 37409074-37409783,37409896-37409986,37410645-374119... 28 4.4 11_06_0017 - 19288171-19288437,19288770-19288989,19291630-19291754 27 5.8 05_01_0542 + 4729099-4729419,4730837-4731086,4731387-4731751 27 5.8 03_03_0246 + 15789635-15794227,15794314-15794555,15794630-157947... 27 5.8 11_06_0316 + 22323814-22324692 27 7.7 08_02_0196 - 14125037-14125175,14125525-14125604,14125938-141264... 27 7.7 07_01_0769 + 5908942-5908946,5909085-5909666,5910370-5910429,591... 27 7.7 02_01_0170 - 1174224-1174321,1174429-1174588,1174673-1174823,117... 27 7.7 >04_04_0378 - 24822436-24822521,24822623-24822738,24823010-24823092, 24823772-24823918,24824004-24824051,24824153-24824353, 24824981-24825152,24825235-24825299,24825813-24825939, 24826436-24826528,24826608-24826696,24826804-24826950, 24827047-24827359,24827474-24828048 Length = 753 Score = 34.3 bits (75), Expect = 0.051 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 7/71 (9%) Frame = -2 Query: 340 TVGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIK-------ALEE 182 TVG + + ++ +S ++ KL +E QE++I++ + ++EKE + LE+ AL+E Sbjct: 498 TVGTVLPS--EDSVSDRKRKLEFLEMQEELIKEEEKRQEKEDKAKLEVPKATEEDVALKE 555 Query: 181 MASGTAKK*KD 149 M TA++ K+ Sbjct: 556 MTEPTAREEKE 566 >10_06_0010 + 9574265-9574524,9574629-9574956,9576663-9576788, 9576948-9577067,9577350-9577562,9577653-9577764, 9578033-9578217,9578310-9578660,9578826-9579383 Length = 750 Score = 33.1 bits (72), Expect = 0.12 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = -2 Query: 472 GFFPKVSYNNCFTVQQFYNQMSDLPYGAPVRISPLIKFGRWSFLTVGVLY---GAFHQNR 302 GF ++S T Q+FY + D P+G + +S L+K GR G+ Y G FH+ + Sbjct: 315 GFDDEISCAFVQTPQKFYGALKDDPFGNQLEVS-LMKVGRGIAGLQGIFYCGTGCFHRRK 373 Query: 301 L 299 + Sbjct: 374 V 374 >07_03_0179 + 14801037-14801108,14801325-14802788 Length = 511 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = -2 Query: 409 SDLPYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKE-AKLREIEAQEKVIRDAKL 233 +DLP AP+ + PL R++FL V ++LSK+E A+L + + + + L Sbjct: 389 TDLPSRAPIELKPLPSGLRYAFLNGDVESPVIISDKLSKEETARLIAVLEKHRAVFGYSL 448 Query: 232 KEEK 221 ++ K Sbjct: 449 QDLK 452 >01_05_0199 - 19174971-19175105,19176302-19176628,19176813-19176915, 19178852-19178916,19179941-19180048,19180213-19180305, 19180395-19180442,19180801-19180899,19180980-19181096, 19181186-19181239,19181312-19181404,19181776-19181881, 19182050-19182084,19182173-19182259,19182385-19182462, 19182528-19182596,19182682-19182780,19183644-19183685, 19184498-19184570,19184654-19184982,19185070-19185127, 19185217-19185269,19186075-19186144,19186276-19186337, 19186452-19186540,19186906-19187011,19187110-19187178, 19187295-19187330 Length = 900 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 310 QNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALE-EMASGTAKK*KDKIVI 137 + RL ++E +E E +EK R K K+EKER K E E G + KD++ I Sbjct: 739 KERLREEEKARKEKEREEKERRKEKEKKEKERKEKERDKEKEREKDKGKDRSRKDEMDI 797 >11_04_0097 + 13448740-13450725 Length = 661 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = -2 Query: 301 LSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTAK 161 + +++A+ A+EK +A KEE+ER A E KA EE A+ ++ Sbjct: 562 VEREKAEAAARAAEEKARAEALAKEEEERKKA-EAKAKEEAAARASR 607 >02_04_0431 - 22841708-22842571,22842659-22842743,22842796-22842869, 22842953-22843002,22843086-22843167,22843941-22843987, 22844089-22844131,22844219-22844299,22844413-22844458, 22844557-22844603,22844709-22844774,22845030-22845096, 22845194-22845279 Length = 545 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 357 PNLIRGDIRTGAPYG-KSDIWL*NCCTVKQLLY 452 PN + +I PYG KSDIW CC + L + Sbjct: 166 PNYMCPEILADIPYGYKSDIWSLGCCMFEILAH 198 >05_07_0216 + 28461783-28461788,28461837-28462295,28463198-28463315, 28463350-28463609,28465220-28465525 Length = 382 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -1 Query: 359 WTLVLPHRRSSIRRLPPEQAIKERSETTRD*SPREGHPRCQAEGGERKSL 210 WT +L ++++RRL + +R T + S + H + E K L Sbjct: 139 WTFLLREIKAAVRRLQELRGEPKRRHTNQQLSQKRNHQKWNTNADEEKKL 188 >05_04_0209 - 19073147-19074041,19074117-19074163,19074258-19074437, 19074839-19074955,19075105-19075227,19075391-19075776, 19076177-19076303,19077140-19077202,19078035-19078086, 19078189-19080023 Length = 1274 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -2 Query: 307 NRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALE 200 + + KK + + A +++ D KLKEEK + + LE Sbjct: 816 DEIDKKVTLMSNVTAINQMLEDIKLKEEKTKQAVLE 851 >08_02_0531 + 18256597-18256836,18257637-18257735,18258038-18258184, 18258295-18258427,18258521-18258585,18258792-18258962, 18259095-18259199,18259495-18259602,18259792-18260088, 18260191-18260256,18260477-18260679,18261178-18261232, 18261318-18261503,18261701-18261985 Length = 719 Score = 28.3 bits (60), Expect = 3.3 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = -2 Query: 307 NRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KD 149 N LS+KEAKLR + QE + R EKE S +++L M K+ D Sbjct: 238 NELSEKEAKLRRL--QEDLSR-----REKEHVSDASLQSLRSMVMALQKENSD 283 >05_07_0247 + 28643862-28644310,28645151-28645207,28645644-28648950, 28649069-28649144,28649356-28649426,28649524-28649589, 28649677-28649766,28649874-28650050,28650513-28650548 Length = 1442 Score = 28.3 bits (60), Expect = 3.3 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = -2 Query: 310 QNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIVI 137 + R KEA R E +E RD K ++E+E A E K LEE ++ KD++ + Sbjct: 1110 REREKDKEASRRLEETKE---RDKKFEKEREIAEERERKKLEEQERERERE-KDRLAV 1163 >05_05_0134 + 22619297-22619801,22619879-22621960,22622067-22623718 Length = 1412 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -2 Query: 289 EAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIV 140 E ++ E + EK++ D +L EE A +EE S T + +DK+V Sbjct: 964 EVQVAETTSTEKIVEDKELAEETTEGEATAEVHIEE-TSTTERTVEDKVV 1012 >04_04_0871 + 28898262-28898534,28899552-28900015,28900242-28900356, 28900510-28901157,28901282-28901374,28901658-28901795, 28902147-28902206 Length = 596 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/45 (28%), Positives = 29/45 (64%) Frame = -2 Query: 298 SKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTA 164 +KK+A+ +E++ +K R+ + ++EKE+A A + + + GT+ Sbjct: 505 AKKKARAKELKKLKKA-REKEKEKEKEKAQASQSQRTQSNVRGTS 548 >01_06_1446 - 37409074-37409783,37409896-37409986,37410645-37411988, 37412062-37412709,37412801-37412852,37413141-37413214, 37414370-37414419,37414488-37414569,37414779-37414828, 37414907-37414949,37415030-37415110,37415198-37415243, 37415336-37415382,37415467-37415532,37415612-37415678, 37415761-37415858 Length = 1182 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 357 PNLIRGDIRTGAPYG-KSDIWL*NCC 431 PN + ++ PYG KSDIW CC Sbjct: 171 PNYMCPELLADIPYGFKSDIWSLGCC 196 >11_06_0017 - 19288171-19288437,19288770-19288989,19291630-19291754 Length = 203 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEE 182 +KE + +EAQ K R+ K +EE E+ E K EE Sbjct: 101 EKEKEAALVEAQHKAERERKEREELEKKLEEERKKAEE 138 >05_01_0542 + 4729099-4729419,4730837-4731086,4731387-4731751 Length = 311 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -2 Query: 310 QNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEI---KALEEMASGTAKK 158 + +LSKKE K +E+E + ++ + +L + + E K E+ A G K+ Sbjct: 152 ERQLSKKELKKKELEELDAILAELELSSKSNNDAQNETNGKKGAEQAADGENKE 205 >03_03_0246 + 15789635-15794227,15794314-15794555,15794630-15794771, 15796089-15796272,15796349-15796696,15796753-15797450, 15798208-15798900 Length = 2299 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/40 (30%), Positives = 27/40 (67%) Frame = -2 Query: 310 QNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKA 191 + R+ +++A+ REI +++ R+ ++EE+ER +E +A Sbjct: 484 RQRVLEEQARAREIVRKQEEERERLIREEEERQRLVEEEA 523 >11_06_0316 + 22323814-22324692 Length = 292 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 401 TIRSTCAYIASNQVWTLVLPHRRSSIRRLPPEQAIKERSETTRD*SPRE 255 TI S ++S ++ H R+ I R P+Q ++RSE +RD + RE Sbjct: 210 TISSGSCELSSPDCLEQLVVHERT-ITRWIPQQCREQRSEASRDEANRE 257 >08_02_0196 - 14125037-14125175,14125525-14125604,14125938-14126463, 14126809-14126852,14127444-14127584,14127696-14128463 Length = 565 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 417 TKCQIYHTEHLCVYRL*SSLDVGPSSP*EFYTAPSTRT 304 TKC++ + +++ V + LDV +P + P+TRT Sbjct: 245 TKCEVEYIQNISVDEKENKLDVTQPAPFQEQVPPTTRT 282 >07_01_0769 + 5908942-5908946,5909085-5909666,5910370-5910429, 5910635-5910674,5910767-5910860,5911582-5911952 Length = 383 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -2 Query: 358 GRWSFLTVGVLYGAFH-QNRLSKKEAKLREIEAQ-EKVIRDAKLKEEKERASALEI 197 GR F+T+ + +F RL K + + + +++DAK K EKER + L++ Sbjct: 167 GREEFITISDIETSFEFDGRLVGKRLVDANVATEIQTIVQDAKGKFEKERQNYLKV 222 >02_01_0170 - 1174224-1174321,1174429-1174588,1174673-1174823, 1175005-1175156,1175647-1175768,1176773-1176785 Length = 231 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 349 SFLTVGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKERAS 209 SF +G+L + S K A ++I + I + K+K EKE A+ Sbjct: 148 SFHYMGLLKNVMRLSMASLKGADAKDISSSIAAIANEKIKAEKEAAA 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,811,711 Number of Sequences: 37544 Number of extensions: 201982 Number of successful extensions: 614 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -