BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0075 (473 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65540.1 68414.m07435 calcium-binding EF hand family protein ... 36 0.014 At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00... 32 0.23 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 31 0.40 At3g05110.1 68416.m00555 hypothetical protein 31 0.53 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 30 0.92 At3g44200.1 68416.m04739 protein kinase family protein contains ... 29 1.2 At5g67240.1 68418.m08475 exonuclease family protein contains exo... 29 1.6 At5g13340.1 68418.m01535 expressed protein 29 2.1 At3g51910.1 68416.m05694 heat shock transcription factor family ... 28 2.8 At3g20860.1 68416.m02637 protein kinase family protein contains ... 28 2.8 At5g37475.1 68418.m04510 translation initiation factor-related s... 28 3.7 At4g17730.1 68417.m02647 syntaxin 23 (SYP23) / PEP12-like protei... 28 3.7 At2g04515.1 68415.m00457 expressed protein 28 3.7 At5g06530.2 68418.m00737 ABC transporter family protein 27 6.5 At5g06530.1 68418.m00736 ABC transporter family protein 27 6.5 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 27 6.5 At4g26630.1 68417.m03837 expressed protein 27 6.5 At2g22795.1 68415.m02704 expressed protein 27 6.5 At2g04495.1 68415.m00454 expressed protein 27 6.5 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 27 6.5 At5g55860.1 68418.m06963 expressed protein contains Pfam profile... 27 8.6 At1g66960.1 68414.m07614 lupeol synthase, putative / 2,3-oxidosq... 27 8.6 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 27 8.6 At1g13220.1 68414.m01533 nuclear matrix constituent protein-rela... 27 8.6 >At1g65540.1 68414.m07435 calcium-binding EF hand family protein similar to leucine zipper-EF-hand containing transmembrane protein 1 [Homo sapiens] GI:4235226; contains Pfam profile PF00036: EF hand Length = 736 Score = 35.9 bits (79), Expect = 0.014 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 6/66 (9%) Frame = -2 Query: 340 TVGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEE------KERASALEIKALEEM 179 TVGV ++ +S+++ KL +E QE++I++ + +EE KE AS+ + AL+EM Sbjct: 479 TVGVT-ALSSEDSVSERKRKLEYLEMQEELIKEEEEEEEEEMAKMKESASSQKDVALDEM 537 Query: 178 ASGTAK 161 + TAK Sbjct: 538 MASTAK 543 >At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 592 Score = 31.9 bits (69), Expect = 0.23 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEE 182 +KEA L IEA+EK R+ + KEE+ER + +K +EE Sbjct: 133 EKEASL--IEAKEKEEREQQEKEERERIAEENLKRVEE 168 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 31.1 bits (67), Expect = 0.40 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -2 Query: 322 GAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKE--RASALEIKALEEMASGTAK 161 G F++ + K++AKLRE + +K ++ KLK +E S E+KA +S K Sbjct: 659 GKFYEKYMKKRDAKLREEWSLKKGEKETKLKSMQEALEQSRTEMKAKLSASSSERK 714 >At3g05110.1 68416.m00555 hypothetical protein Length = 372 Score = 30.7 bits (66), Expect = 0.53 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = -2 Query: 304 RLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIK 194 +L +E +LRE+EA+ K D K KE +E+ LE+K Sbjct: 68 QLEARENELREVEAKRKFF-DLKEKELEEKEKELELK 103 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 29.9 bits (64), Expect = 0.92 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 310 QNRLSKKEAKLREIEAQEKVIRDAKLK-EEKERASALEIKALEEM 179 Q R+ +EAK +EIEA + V+ D KL+ + + + EI L+ + Sbjct: 909 QMRMEIEEAKSQEIEALQSVLTDIKLQLRDTQETKSKEISDLQSV 953 >At3g44200.1 68416.m04739 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 941 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 357 PNLIRGDIRTGAPYG-KSDIWL*NCCTVKQLLY 452 PN + ++ PYG KSDIW CC + Y Sbjct: 171 PNYMCPELLADIPYGFKSDIWSLGCCIYEMAAY 203 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKERASA 206 K AK +I+AQ+K+I + K+K EK+++ + Sbjct: 714 KLNAKEHQIQAQDKIIANLKMKLEKKQSKS 743 >At5g13340.1 68418.m01535 expressed protein Length = 242 Score = 28.7 bits (61), Expect = 2.1 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKERASAL-EIKALEEMA 176 K+E + R EA EK+ D +++ +KE+ +AL E + EE A Sbjct: 118 KEEIERRTKEAYEKMFLDVEIQLKKEKEAALNEARRKEEQA 158 >At3g51910.1 68416.m05694 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 272 Score = 28.3 bits (60), Expect = 2.8 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 349 SFLTVGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASG 170 SFL + +F L +++ K++E+E E AK K S LE+ ALE G Sbjct: 180 SFLARAMQSPSFLHQLLKQRDKKIKELEDNE----SAKRKRGSSSMSELEVLALEMQGHG 235 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 28.3 bits (60), Expect = 2.8 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 357 PNLIRGDIRTGAPYG-KSDIWL*NCCTVKQLLYDTFGKNP 473 PN + ++ PYG KSDIW CC + + K P Sbjct: 177 PNYMCPELLADIPYGYKSDIWSLGCCMFEVAAHQPAFKAP 216 >At5g37475.1 68418.m04510 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 225 Score = 27.9 bits (59), Expect = 3.7 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -2 Query: 370 LIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKERAS 209 L+ F + SF +G+L + + K A ++++ + I + KLK EKE A+ Sbjct: 139 LVPFEK-SFHYIGLLKAVMRLSVANMKAADVKDVASSITAIANEKLKAEKEAAA 191 >At4g17730.1 68417.m02647 syntaxin 23 (SYP23) / PEP12-like protein identical to SP|O04378 Syntaxin 23 (AtSYP23) (AtPLP) (AtPEP12-like protein) {Arabidopsis thaliana} Length = 255 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 4 GGGTRERTSLDLFSPIFSLNKLITT 78 GGG+R+ T+ D+ S IF +N ++T Sbjct: 22 GGGSRQDTTQDVASGIFQINTSVST 46 >At2g04515.1 68415.m00457 expressed protein Length = 196 Score = 27.9 bits (59), Expect = 3.7 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = -2 Query: 337 VGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 158 VG + G+FH N S K I Q K + LKE K + LEE S +K+ Sbjct: 66 VGFILGSFHGNSDSLSHGKAINIVEQTKEVGIKDLKETKVNK---VVALLEE--SNVSKE 120 Query: 157 *KDKIVIS 134 + ++V+S Sbjct: 121 EEGRVVLS 128 >At5g06530.2 68418.m00737 ABC transporter family protein Length = 691 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 255 FSWASISRSFAS-FFDSLFWWKAPYRTPTVRKDQ 353 FSW +++ ++ L WW++ RTP +DQ Sbjct: 516 FSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQ 549 >At5g06530.1 68418.m00736 ABC transporter family protein Length = 751 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 255 FSWASISRSFAS-FFDSLFWWKAPYRTPTVRKDQ 353 FSW +++ ++ L WW++ RTP +DQ Sbjct: 516 FSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQ 549 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKE 218 K E + R +EA+EK ++ K+KE++E Sbjct: 683 KAENERRAVEAREKAEQERKMKEQQE 708 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 27.1 bits (57), Expect = 6.5 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = -2 Query: 295 KKEAKLREIEAQEKVIRDAKLKEEKE 218 K+E K +E+EA + + ++K+++EKE Sbjct: 220 KEENKTKEVEAAKAEVDESKVEDEKE 245 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 298 SKKEAKLREIEAQEKVIRDAKLKEEKERASALEIKALEE 182 S++E +E EA+EKV ++ K E + +E LEE Sbjct: 462 SQEETMDKETEAKEKVESSSQEKNEDKETEKIESSFLEE 500 >At2g04495.1 68415.m00454 expressed protein Length = 202 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -2 Query: 337 VGVLYGAFHQNRLSKKEAKLREIEAQEKVIRDAKLKEEK 221 VG + G+FH N S + K I Q K + LKE K Sbjct: 66 VGFILGSFHGNSESLSQGKAINIIEQTKEVGIKDLKETK 104 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -2 Query: 229 EEKERASALEIKALEEMASGTAKK*KDKIVIS 134 E++ R SALE + LEE+ +A + ++K+ IS Sbjct: 103 EDRIRISALEAEKLEELQKQSASELEEKLKIS 134 >At5g55860.1 68418.m06963 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 649 Score = 26.6 bits (56), Expect = 8.6 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = -2 Query: 298 SKKEAKLREIEAQEKVIRDAKLK-----EEKERASALEIKALEEMASGTAK 161 +K + ++E E+ + D++L +E E A A E KALE++ S + K Sbjct: 411 NKAKELMKEAESAHLALEDSELHLRVALDEAEEAKAAETKALEQIKSMSEK 461 >At1g66960.1 68414.m07614 lupeol synthase, putative / 2,3-oxidosqualene-triterpenoid cyclase, putative similar to lupeol synthase GI:1762150 from [Arabidopsis thaliana], 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana] GI:2738027 Length = 763 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -2 Query: 403 LPYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLRE 272 LPY P+ + + R +++ + LYG +++ +LRE Sbjct: 246 LPYFLPIHLGKAFSYTRITYMPISYLYGKKFVGQITPLIMQLRE 289 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 298 SKKEAKLREIEAQEKVIRDAKLKEEKERAS 209 S+ + +L+E+E +E V++ +L KER S Sbjct: 224 SELKLRLKEVETRESVLQQERLSFTKERES 253 >At1g13220.1 68414.m01533 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 391 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 298 SKKEAKLREIEAQEKVIRDAKLKEEKERAS 209 S+ + +L+E+E +E V++ +L KER S Sbjct: 237 SELKLRLKEVETRESVLQQERLSFTKERES 266 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,522,388 Number of Sequences: 28952 Number of extensions: 168288 Number of successful extensions: 638 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -