BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0072 (417 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 24 2.5 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 24 2.5 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 24 2.5 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 24 2.5 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 4.5 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 4.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 4.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 5.9 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 23 5.9 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 7.8 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 22 7.8 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 22 7.8 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 22 7.8 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 22 7.8 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 22 7.8 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 22 7.8 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 22 7.8 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 22 7.8 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 22 7.8 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 22 7.8 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 22 7.8 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 22 7.8 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 22 7.8 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 22 7.8 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 22 7.8 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 22 7.8 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.6 bits (51), Expect = 1.5 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +1 Query: 214 AVLPLIKYNDPRFRTVEAGPTLGHYWKNGKEIENTEDYVEEVYDASQYHGQDGLGAYA 387 A+L K ND + G L + NGK + E Y E+Y Q + YA Sbjct: 1738 AILGQYKQNDYNIDIIPHGHELPMVYINGKPQQIHEKYAVEMYTNDDGGDQPLIRVYA 1795 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.8 bits (49), Expect = 2.5 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 148 PEEAQKYLNSPPFTDPQLAGRTAVLP---LIKYNDPRFRTVEAGPTLGHYWKNG 300 P +AQ L SP + G V Y+ FR + G L H+W NG Sbjct: 366 PSDAQGNLLSPIINPDKTCGGGWVCEHRWRQMYSMIHFRNLAWGTPLRHWWDNG 419 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 168 VLLCFFGLDVNLEDVDAGFRRRRHNC 91 VLL G+D +L+ V++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 168 VLLCFFGLDVNLEDVDAGFRRRRHNC 91 VLL G+D +L+ V++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 168 VLLCFFGLDVNLEDVDAGFRRRRHNC 91 VLL G+D +L+ V++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 316 TEDYVEEVYDASQYHGQDGLGAYAYGYQ 399 T D V EV D D +G+YA+G + Sbjct: 174 TSDDVVEVRDLMARFTTDVIGSYAFGLE 201 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.0 bits (47), Expect = 4.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 282 SKSGACFNCAKP 247 SK GACF C +P Sbjct: 71 SKPGACFFCGQP 82 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 4.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 186 HYSAPIAHHAAPITHYAAPIAHH 208 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 5.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 288 VVSKSGACFNCAK 250 +V K G CFNC + Sbjct: 370 IVRKHGLCFNCLR 382 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 22.6 bits (46), Expect = 5.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 180 WAV*VLLCFFGLDV 139 W V ++LCFF D+ Sbjct: 4 WTVVIVLCFFATDL 17 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 333 RSIRCVPIPRTRRSRCICLR 392 R++RC PRTRRS + R Sbjct: 32 RTVRC---PRTRRSEAVMTR 48 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 22.2 bits (45), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 403 EFGIRRHMHLDRLVRGIG 350 ++ + RH H+ RLV IG Sbjct: 331 KYWVERHKHVVRLVSAIG 348 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 22.2 bits (45), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 62 LRMCLFSPWSQLCL 103 L +CL PW+ +CL Sbjct: 250 LVLCLLVPWTCICL 263 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 22.2 bits (45), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 403 EFGIRRHMHLDRLVRGIG 350 ++ + RH H+ RLV IG Sbjct: 184 KYWVERHKHVVRLVSAIG 201 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 22.2 bits (45), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 403 EFGIRRHMHLDRLVRGIG 350 ++ + RH H+ RLV IG Sbjct: 331 KYWVERHKHVVRLVSAIG 348 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.2 bits (45), Expect = 7.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 358 GIGTHRILLQRSP 320 GIGTH + QR P Sbjct: 352 GIGTHLVTCQRQP 364 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 22.2 bits (45), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 62 LRMCLFSPWSQLCL 103 L +CL PW+ +CL Sbjct: 250 LVLCLLVPWTCICL 263 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 186 HYSAPIAHHAAPIAHYAAPIAHH 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 182 HYSAPIAHHAAPIAHYAAPIAHH 204 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 194 HYSAPIAHHAAPIAHYAAPIAHH 216 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 194 HYSAPIAHHAAPIAHYAAPIAHH 216 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 218 HYSAPIAHHAAPIAHYAAPIAHH 240 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 186 HYSAPIAHHAAPIAHYAAPIAHH 208 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 158 HRST*TAHHSQILN*LAAPLSYH 226 H S AHH+ + AAP+++H Sbjct: 194 HYSAPIAHHAAPIAHYAAPIAHH 216 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -1 Query: 147 LDVNLEDVDAGFRRRRHNCDHGENRHIRSMFLLFFFNSIDVSQYSSACS 1 L + + A + R H+ H R R F + +V ++ S CS Sbjct: 14 LYTTVSEPSASTKHRHHSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -1 Query: 147 LDVNLEDVDAGFRRRRHNCDHGENRHIRSMFLLFFFNSIDVSQYSSACS 1 L + + A + R H+ H R R F + +V ++ S CS Sbjct: 14 LYTTVSEPSASTKHRHHSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -1 Query: 147 LDVNLEDVDAGFRRRRHNCDHGENRHIRSMFLLFFFNSIDVSQYSSACS 1 L + + A + R H+ H R R F + +V ++ S CS Sbjct: 14 LYTTVSEPSASTKHRHHSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 449,894 Number of Sequences: 2352 Number of extensions: 8463 Number of successful extensions: 41 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -