BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0063 (551 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 1.4 SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 26 3.2 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 27.5 bits (58), Expect = 1.4 Identities = 18/60 (30%), Positives = 23/60 (38%), Gaps = 7/60 (11%) Frame = -1 Query: 473 PPVNCTRPNE---VWCPSPPPC----LQETCDDVDLPPVPCNEFIKSSPRCICKDNYFRN 315 PPV C P C P C ++ C P PC F+K RC+C + N Sbjct: 631 PPVACGTPIPDCPYLCVLPKSCHHPQVKHNCHPTSEPCPPCPYFVKK--RCLCGKHILEN 688 >SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 283 Score = 26.2 bits (55), Expect = 3.2 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -1 Query: 449 NEVWCPSPPPCLQETCDDVDLPPVPCNEFIKSS-PRCICKDNYFRNDSGICVCAQECRDI 273 N C + P L TC + PV CN +++ C++ ++ GICV + R Sbjct: 194 NMTLCNTDYPYLVNTCFNGTQYPVNCNSALRTPFGGATCRNIGYKG-QGICVYTNDSRIP 252 Query: 272 NAPDY 258 A D+ Sbjct: 253 VADDH 257 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,961,484 Number of Sequences: 5004 Number of extensions: 38927 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -