BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0062 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) 29 3.6 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 29 4.8 >SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) Length = 1222 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +3 Query: 273 GIVFKVVCKCSALLLPWRSRCVFKMALFHFIPFRKHNTNMPHNRLPVSINLLNSMQYLCS 452 G++ +V + +A+L+ R +CVF F + + H+R V N N + +L S Sbjct: 553 GLLGEVRRRIAAVLIVHRHQCVFAYVRLRLFAFARLHYPTLHSRRVVDTNNANRLHFLTS 612 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +2 Query: 494 NYSANLQC---GTIFAVKRKKAKLNFVSFSFTRSTVTQPEK*FTLQKIHSTYIIKLITKN 664 NYS NL T +V + +LNF S TRST+ P K F L+ ++Y+ +L K Sbjct: 1711 NYSVNLTITFTATDNSVSSRCGELNFTGLSGTRSTIGLPLKEF-LE--GASYVFRL--KI 1765 Query: 665 IRDCR 679 ++D R Sbjct: 1766 LKDAR 1770 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,138,029 Number of Sequences: 59808 Number of extensions: 364921 Number of successful extensions: 1515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1514 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -