BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0062 (703 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81138-2|CAB03473.1| 2265|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z69716-6|CAA93525.1| 124|Caenorhabditis elegans Hypothetical pr... 28 7.4 >Z81138-2|CAB03473.1| 2265|Caenorhabditis elegans Hypothetical protein W05B2.4 protein. Length = 2265 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/48 (31%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 150 IKRLKQIEKYNHKTH*PHYQIVIIS*MSNIRLEIRLYVPN-GGIVFKV 290 + RL +IEKY+H H + + +++ S ++IR++ N G++F+V Sbjct: 163 LARLNKIEKYHH--HVKNNREILLRSQSLAAMKIRIFFENRKGLIFEV 208 >Z69716-6|CAA93525.1| 124|Caenorhabditis elegans Hypothetical protein C04B4.6 protein. Length = 124 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 497 YSANLQCGTIFAVKRKKAKLNFVS--FSFTRSTVTQPEK*FTLQKIHSTYI 643 YS L I + K+ KLNF S F+FT + V +P FT I + +I Sbjct: 21 YSMPLAFCCINTINIKRGKLNFRSSFFAFTPNKVLKPSNIFTSFVIMANFI 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,505,290 Number of Sequences: 27780 Number of extensions: 288035 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -