BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0060 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 24 3.7 AY745214-1|AAU93481.1| 72|Anopheles gambiae cytochrome P450 pr... 23 8.5 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 160 ELESDVLHVLGVMCILRGPSHPTQLCLKEFAELSHTRAFSLR 35 +L D++HV+G P P Q E E H +A R Sbjct: 23 DLLDDIIHVIGKDIREEMPPVPNQRPYVEITEQPHPKALRFR 64 >AY745214-1|AAU93481.1| 72|Anopheles gambiae cytochrome P450 protein. Length = 72 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 353 RSYRCIYRFISLQATASSFPILYSSLDLNLLQSLE 249 R CIYR AT SS + ++ L+L++ ++ Sbjct: 16 RYIECIYRLTKDYATESSCVNIIRNMSLDLMKEVK 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,386 Number of Sequences: 2352 Number of extensions: 10608 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -