BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0059 (377 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 31 0.31 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 0.95 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 1.7 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 29 1.7 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 28 2.2 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 2.9 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 28 2.9 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 2.9 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 27 3.8 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 3.8 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 27 5.1 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 27 5.1 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 27 6.7 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 27 6.7 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 27 6.7 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 27 6.7 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 27 6.7 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 27 6.7 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_23292| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 27 6.7 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) 27 6.7 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 27 6.7 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 27 6.7 SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 27 6.7 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_17327| Best HMM Match : DUF1161 (HMM E-Value=3) 26 8.8 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_4752| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 26 8.8 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.1 bits (67), Expect = 0.31 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 VPA+N PGDPLVLER Sbjct: 8 VPASNSCSPGDPLVLER 24 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 31.1 bits (67), Expect = 0.31 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 +F P++N PGDPLVLER Sbjct: 137 HFAPSSNSCSPGDPLVLER 155 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N+ P +N PGDPLVLER Sbjct: 68 NWYPPSNSCSPGDPLVLER 86 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F P +N PGDPLVLER Sbjct: 44 FKPTSNSCSPGDPLVLER 61 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 PA+N PGDPLVLER Sbjct: 18 PASNSCSPGDPLVLER 33 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 VP +N PGDPLVLER Sbjct: 15 VPPSNSCSPGDPLVLER 31 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 IN + +N PGDPLVLER Sbjct: 19 INIIRQSNSCSPGDPLVLER 38 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N P +N PGDPLVLER Sbjct: 60 NLRPVSNSCSPGDPLVLER 78 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.1 bits (62), Expect = 1.3 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -2 Query: 61 NFVPAT--NYLQPGDPLVLER 5 NFV AT N PGDPLVLER Sbjct: 66 NFVTATESNSCSPGDPLVLER 86 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 97 NLILCRHFV**INFVPATNYLQPGDPLVLER 5 N++ R FV + +N PGDPLVLER Sbjct: 12 NIVFLREFVYTVIQKVVSNSCSPGDPLVLER 42 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 +P +N PGDPLVLER Sbjct: 181 IPPSNSCSPGDPLVLER 197 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 ++F+P+ N PGDPLVLER Sbjct: 50 VHFIPS-NSCSPGDPLVLER 68 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 6 RSRTSGSPGCR*FVAGTKFIYQTKC 80 RSRTSGSPG + F G + T+C Sbjct: 11 RSRTSGSPGLQEFDIGVRLSACTRC 35 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 +P +N PGDPLVLER Sbjct: 15 IPLSNSCSPGDPLVLER 31 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N + A+N PGDPLVLER Sbjct: 12 NILHASNSCSPGDPLVLER 30 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +LQPGDPLVLER Sbjct: 29 VDRIEFLQPGDPLVLER 45 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 28.3 bits (60), Expect = 2.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -2 Query: 130 VPFGFAMTNHNNLILCRHFV**INFVPATNYLQPGDPLVLER 5 +P A +++ ++I H V + F+ +N PGDPLVLER Sbjct: 492 IPDSPATSSYKDIIESTHIV--VTFL--SNSCSPGDPLVLER 529 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 2.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 76 FV**INFVPATNYLQPGDPLVLER 5 FV ++F +N PGDPLVLER Sbjct: 10 FVWVLSFFSPSNSCSPGDPLVLER 33 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F A+N PGDPLVLER Sbjct: 9 FYSASNSCSPGDPLVLER 26 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 28.3 bits (60), Expect = 2.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 +P +N PGDPLVLER Sbjct: 137 LPGSNSCSPGDPLVLER 153 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 2.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 + FVP+ N PGDPLVLER Sbjct: 9 LGFVPS-NSCSPGDPLVLER 27 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 2.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 +F+ ++N PGDPLVLER Sbjct: 10 SFLSSSNSCSPGDPLVLER 28 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 29 PVSNSCSPGDPLVLER 44 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 24 PGSNSCSPGDPLVLER 39 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 +P +N PGDPLVLER Sbjct: 1 MPRSNSCSPGDPLVLER 17 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N P +N PGDPLVLER Sbjct: 18 NSRPRSNSCSPGDPLVLER 36 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 15 PTSNSCSPGDPLVLER 30 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 20 PTSNSCSPGDPLVLER 35 >SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 140 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N V ++N PGDPLVLER Sbjct: 12 NIVGSSNPRSPGDPLVLER 30 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N V +N PGDPLVLER Sbjct: 12 NIVHISNSCSPGDPLVLER 30 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 2 PVSNSCSPGDPLVLER 17 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N + A+N PGDPLVLER Sbjct: 2 NNLTASNSCSPGDPLVLER 20 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 2.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 106 NHNNLILCRHFV**INFVPATNYLQPGDPLVLER 5 N+ +++L RH I +N PGDPLVLER Sbjct: 13 NYKHVLLDRHEHVTICSYRISNSCSPGDPLVLER 46 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 4 VQASNSCSPGDPLVLER 20 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 ++ A+N PGDPLVLER Sbjct: 16 YLTASNSCSPGDPLVLER 33 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 58 PVSNSCSPGDPLVLER 73 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F A+N PGDPLVLER Sbjct: 4 FFHASNSCSPGDPLVLER 21 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 9 VDASNSCSPGDPLVLER 25 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 22 VAASNSCSPGDPLVLER 38 >SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 2.9 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 167 LSDKGRQEAVAAGKALKAEGYQFDIAHTSVLKRAQITLNSILKEIGQPDIP---VEKTWR 337 ++++G ++ +A K+ KA G D H VLK ++ ILK+I Q + + + WR Sbjct: 53 VTEEGVRKLLAGLKSSKAAGP--DSFHPRVLKECAPVISPILKQIFQKSLDAGNLPREWR 110 Query: 338 LNERH 352 + +++ Sbjct: 111 IAKKY 115 >SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) Length = 534 Score = 27.9 bits (59), Expect = 2.9 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = +2 Query: 167 LSDKGRQEAVAAGKALKAEGYQFDIAHTSVLKRAQITLNSILKEIGQPDIP---VEKTWR 337 ++++G ++ +A K+ KA G D H VLK + ++ ILK+I Q + + + WR Sbjct: 329 VTEEGVRKLLAGLKSSKAAGP--DGFHPRVLKECALVISPILKQIFQKSLDACNLPREWR 386 Query: 338 L 340 + Sbjct: 387 I 387 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 5 PTSNSCSPGDPLVLER 20 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 24 PGSNSCSPGDPLVLER 39 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 11 PGSNSCSPGDPLVLER 26 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 FV +N PGDPLVLER Sbjct: 2 FVVRSNSCSPGDPLVLER 19 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 32 VHASNSCSPGDPLVLER 48 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 63 PLSNSCSPGDPLVLER 78 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 19 PPSNSCSPGDPLVLER 34 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 68 PRSNSCSPGDPLVLER 83 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 16 PRSNSCSPGDPLVLER 31 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 39 PPSNSCSPGDPLVLER 54 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 30 PQSNSCSPGDPLVLER 45 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N A+N PGDPLVLER Sbjct: 353 NEASASNSCSPGDPLVLER 371 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N VP + PGDPLVLER Sbjct: 17 NGVPKASQHSPGDPLVLER 35 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 + A+N PGDPLVLER Sbjct: 4 ISASNSCSPGDPLVLER 20 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 + A+N PGDPLVLER Sbjct: 37 IKASNSCSPGDPLVLER 53 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P +N PGDPLVLER Sbjct: 96 PPSNSCSPGDPLVLER 111 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N + +N PGDPLVLER Sbjct: 12 NILAGSNSCSPGDPLVLER 30 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F A+N PGDPLVLER Sbjct: 50 FRVASNSCSPGDPLVLER 67 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 5.1 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 CRHFV**INFVPATNYLQPGDPLVLER 5 CR + IN A+N PGDPLVLER Sbjct: 3 CRGEITEINST-ASNSCSPGDPLVLER 28 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 16 VLASNSCSPGDPLVLER 32 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 + A+N PGDPLVLER Sbjct: 250 INASNSCSPGDPLVLER 266 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 I+ A+N PGDPLVLER Sbjct: 3 ISTCEASNSCSPGDPLVLER 22 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N + +N PGDPLVLER Sbjct: 14 NHLKVSNSCSPGDPLVLER 32 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 + A+N PGDPLVLER Sbjct: 11 IVASNSCSPGDPLVLER 27 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.1 bits (57), Expect = 5.1 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 127 PFGFAMTNHNNLILCRHFV**INFVPATNYLQPGDPLVLER 5 P+ T +I H + A+N PGDPLVLER Sbjct: 7 PWACCHTRRVTVITFVHTTSYLTIHSASNSCSPGDPLVLER 47 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V A+N PGDPLVLER Sbjct: 3 VLASNSCSPGDPLVLER 19 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F A+N PGDPLVLER Sbjct: 533 FGNASNSCSPGDPLVLER 550 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 14 ASNSCSPGDPLVLER 28 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 6 ASNSCSPGDPLVLER 20 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 23 ASNSCSPGDPLVLER 37 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 30 ASNSCSPGDPLVLER 44 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2 ASNSCSPGDPLVLER 16 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 52 PATNYLQPGDPLVLER 5 P+ + PGDPLVLER Sbjct: 153 PSNGHRNPGDPLVLER 168 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 3 ASNSCSPGDPLVLER 17 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V ++N PGDPLVLER Sbjct: 11 VTSSNSCSPGDPLVLER 27 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 6 ASNSCSPGDPLVLER 20 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 19 ASNSCSPGDPLVLER 33 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 42 ASNSCSPGDPLVLER 56 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 38 ASNSCSPGDPLVLER 52 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 20 ASNSCSPGDPLVLER 34 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 26.6 bits (56), Expect = 6.7 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 +N PA N PGDPLVLER Sbjct: 790 VNLKPARN---PGDPLVLER 806 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 482 ASNSCSPGDPLVLER 496 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 53 ASNSCSPGDPLVLER 67 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 6 ASNSCSPGDPLVLER 20 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 83 ASNSCSPGDPLVLER 97 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N+ +N PGDPLVLER Sbjct: 3 NWCKLSNSCSPGDPLVLER 21 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 I+ + ++N PGDPLVLER Sbjct: 9 IHVLNSSNSCSPGDPLVLER 28 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 32 ASNSCSPGDPLVLER 46 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 25 ASNSCSPGDPLVLER 39 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 10 ASNSCSPGDPLVLER 24 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 IN +N PGDPLVLER Sbjct: 155 INCEVGSNSCSPGDPLVLER 174 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 6 ASNSCSPGDPLVLER 20 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V ++N PGDPLVLER Sbjct: 12 VSSSNSCSPGDPLVLER 28 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 14 ASNSCSPGDPLVLER 28 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 26.6 bits (56), Expect = 6.7 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 241 CSHVCSKTCPDYTELYLKGDRSARYTC*ENLEIEREA 351 CS C Y E Y+ RY C N+ + REA Sbjct: 1120 CSDKYEPLCSVYLEEYINRCELHRYACTLNINVGREA 1156 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 29 ASNSCSPGDPLVLER 43 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 20 ASNSCSPGDPLVLER 34 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 1193 ASNSCSPGDPLVLER 1207 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 52 ASNSCSPGDPLVLER 66 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 7 ASNSCSPGDPLVLER 21 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 40 YLQPGDPLVLER 5 Y+ PGDPLVLER Sbjct: 40 YVSPGDPLVLER 51 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 6.7 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 82 RHFV**INFVPA-TNYLQPGDPLVLER 5 RHF+ I + +N PGDPLVLER Sbjct: 26 RHFLFVIEVLTGLSNSCSPGDPLVLER 52 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 14 ASNSCSPGDPLVLER 28 >SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2 ASNSCSPGDPLVLER 16 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2422 ASNSCSPGDPLVLER 2436 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 26.6 bits (56), Expect = 6.7 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 226 LSV*HCSHVCSKTCPDYTELYLKGDRSARYT---C*ENLEIEREALW 357 LSV CSHVCS+ +T L+ G R Y C +L + +W Sbjct: 1326 LSVRVCSHVCSRV---FTVLFACGHRLFSYVIFFCSSHLSVRGPYVW 1369 >SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2 ASNSCSPGDPLVLER 16 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 5 ASNSCSPGDPLVLER 19 >SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 4 ASNSCSPGDPLVLER 18 >SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 126 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 3 ASNSCSPGDPLVLER 17 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 47 ASNSCSPGDPLVLER 61 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F +N PGDPLVLER Sbjct: 11 FTDPSNSCSPGDPLVLER 28 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 26 ASNSCSPGDPLVLER 40 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 13 ASNSCSPGDPLVLER 27 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 21 ASNSCSPGDPLVLER 35 >SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 3 ASNSCSPGDPLVLER 17 >SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2 ASNSCSPGDPLVLER 16 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 11 ASNSCSPGDPLVLER 25 >SB_23292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 3 ASNSCSPGDPLVLER 17 >SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 2 ASNSCSPGDPLVLER 16 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 10 ASNSCSPGDPLVLER 24 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 43 ASNSCSPGDPLVLER 57 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 21 ASNSCSPGDPLVLER 35 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 10 ASNSCSPGDPLVLER 24 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 19 ASNSCSPGDPLVLER 33 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N + +N PGDPLVLER Sbjct: 85 NLLLTSNSCSPGDPLVLER 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 12 ASNSCSPGDPLVLER 26 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 38 ASNSCSPGDPLVLER 52 >SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 127 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 3 ASNSCSPGDPLVLER 17 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 21 ASNSCSPGDPLVLER 35 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 5 ASNSCSPGDPLVLER 19 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 15 ASNSCSPGDPLVLER 29 >SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 IN + ++ + PGDPLVLER Sbjct: 158 INSLRSSKPIDPGDPLVLER 177 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 12 ASNSCSPGDPLVLER 26 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 159 ASNSCSPGDPLVLER 173 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 4 ASNSCSPGDPLVLER 18 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 +F+ +N PGDPLVLER Sbjct: 19 HFLLPSNSCSPGDPLVLER 37 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 7 ASNSCSPGDPLVLER 21 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 662 ASNSCSPGDPLVLER 676 >SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 5 ASNSCSPGDPLVLER 19 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 21 ASNSCSPGDPLVLER 35 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 8 ASNSCSPGDPLVLER 22 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 5 ASNSCSPGDPLVLER 19 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 97 ASNSCSPGDPLVLER 111 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 6 ASNSCSPGDPLVLER 20 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A+N PGDPLVLER Sbjct: 8 ASNSCSPGDPLVLER 22 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.2 bits (55), Expect = 8.8 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -2 Query: 97 NLILCRHFV**INFVPATNYLQPGDPLVLER 5 N++L ++ V + +P+ N PGDPLVLER Sbjct: 12 NILLLKNVVW-LQLLPS-NSCSPGDPLVLER 40 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F+P+ N PGDPLVLER Sbjct: 6 FLPS-NSCSPGDPLVLER 22 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N +N PGDPLVLER Sbjct: 12 NIKAGSNSCSPGDPLVLER 30 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F +N PGDPLVLER Sbjct: 5 FQATSNSCSPGDPLVLER 22 >SB_17327| Best HMM Match : DUF1161 (HMM E-Value=3) Length = 345 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 286 YLKGDRSARYTC*ENLEIEREA 351 Y+ GDRSA + ENL IE +A Sbjct: 32 YVTGDRSATFISSENLRIELKA 53 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 78 VATSNSCSPGDPLVLER 94 >SB_4752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 26.2 bits (55), Expect = 8.8 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +2 Query: 35 QVICSRYEIYLSNKMPAKYKIVMIRHGESEWNQKNLFCGWFDADLSDKGRQEAVAAG 205 Q +C+ ++++ S +PA Y + H E + +N F D D SD RQ+ + +G Sbjct: 95 QALCTDWKMFPSQDIPAMYNYGHLYHYLVE-SLQNEFLDLADEDKSD--RQKFIKSG 148 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 ++ +N PGDPLVLER Sbjct: 16 YIRESNSCSPGDPLVLER 33 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 + F +N PGDPLVLER Sbjct: 20 VRFPLISNSCSPGDPLVLER 39 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 49 ATNYLQPGDPLVLER 5 A L+PGDPLVLER Sbjct: 190 APEVLRPGDPLVLER 204 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F +N PGDPLVLER Sbjct: 2 FYSISNSCSPGDPLVLER 19 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 64 INFVPATNYLQPGDPLVLER 5 +N +N PGDPLVLER Sbjct: 1 MNKAEVSNSCSPGDPLVLER 20 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 29 VTGSNSCSPGDPLVLER 45 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 55 VPA-TNYLQPGDPLVLER 5 +PA +N PGDPLVLER Sbjct: 34 IPALSNSCSPGDPLVLER 51 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 89 VSTSNSCSPGDPLVLER 105 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 6 VQTSNSCSPGDPLVLER 22 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 23 VEGSNSCSPGDPLVLER 39 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 58 FVPATNYLQPGDPLVLER 5 F +N PGDPLVLER Sbjct: 61 FPETSNSCSPGDPLVLER 78 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 8 VTVSNSCSPGDPLVLER 24 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 55 VPATNYLQPGDPLVLER 5 V +N PGDPLVLER Sbjct: 191 VAVSNSCSPGDPLVLER 207 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 61 NFVPATNYLQPGDPLVLER 5 N +N PGDPLVLER Sbjct: 12 NISQTSNSCSPGDPLVLER 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,876,691 Number of Sequences: 59808 Number of extensions: 184381 Number of successful extensions: 2031 Number of sequences better than 10.0: 168 Number of HSP's better than 10.0 without gapping: 2009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2030 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -