BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0057 (370 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6BSB0 Cluster: Similar to CA4953|IPF4567.3 Candida alb... 32 2.9 UniRef50_Q8IJR1 Cluster: Putative uncharacterized protein; n=1; ... 31 5.1 UniRef50_Q23KD6 Cluster: Putative uncharacterized protein; n=1; ... 31 8.9 >UniRef50_Q6BSB0 Cluster: Similar to CA4953|IPF4567.3 Candida albicans IPF4567.3 unknown function; n=1; Debaryomyces hansenii|Rep: Similar to CA4953|IPF4567.3 Candida albicans IPF4567.3 unknown function - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 860 Score = 32.3 bits (70), Expect = 2.9 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 184 LKQCKILNINF*DIFLC*LAIENYWNLYINT*SKNFVSLFTK-IARTEEY 330 L + KIL INF L + E YW + IN+ KN + L + + R +Y Sbjct: 317 LPKLKILRINFNQFILPLVNPERYWKISINSDDKNLIHLLERTLERNVKY 366 >UniRef50_Q8IJR1 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 755 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 133 ISENVKSSGVKKTTDHFLKQCKILNINF*DIFL 231 +S NVKSS +KK + +K +NIN DI+L Sbjct: 162 LSSNVKSSHIKKDNKNIMKYTNNVNINDNDIYL 194 >UniRef50_Q23KD6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 422 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -3 Query: 248 SIAN*HKNISQKFIFKILHCFRK*SVVFFTPELFTFSEMCPFRNCIFNCN 99 ++ + ++N+S +I+ LH FR+ V + F + NC+FN N Sbjct: 61 AVTDKYRNVSPYYIY--LHSFRQLCVYLIYLSIIIFMILADIENCLFNIN 108 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,347,460 Number of Sequences: 1657284 Number of extensions: 4403347 Number of successful extensions: 8769 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8769 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 13647406432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -