BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0057 (370 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 2.8 SPAC186.09 |||pyruvate decarboxylase |Schizosaccharomyces pombe|... 25 3.7 >SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 25.4 bits (53), Expect = 2.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 274 Y*YIDSSNFQLLINTKIYLKSLYLKFYT 191 Y ++D + IN YL Y+ FYT Sbjct: 458 YTFVDPYTYACYINNNSYLPPSYMDFYT 485 >SPAC186.09 |||pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 572 Score = 25.0 bits (52), Expect = 3.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 30 YSYGNSKRV*NSTLSIQRARELTVTIEYAI 119 Y Y +K++ + +SIQR E I+YAI Sbjct: 134 YQYEMAKKITCAAVSIQRPTEAPRLIDYAI 163 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,261,534 Number of Sequences: 5004 Number of extensions: 21624 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 116121426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -