BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0053 (409 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 9.9 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 22 9.9 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 21.8 bits (44), Expect = 9.9 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -1 Query: 301 LCSAQLLVRTSETHLMFMRLYNLISLLIQFC 209 LC+ ++ R+ F+ L L +L ++FC Sbjct: 97 LCNEAIMARSKLLPNSFVHLARLKALSLEFC 127 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 21.8 bits (44), Expect = 9.9 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = +1 Query: 175 FNINLMTLKYRYKIEL 222 F++NL+ ++R+K++L Sbjct: 1186 FDLNLVNFEHRFKLDL 1201 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 336,575 Number of Sequences: 2352 Number of extensions: 5275 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -