BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0052 (615 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81571-11|CAC35914.1| 1579|Caenorhabditis elegans Hypothetical p... 29 3.5 AL132848-7|CAC35915.1| 1579|Caenorhabditis elegans Hypothetical ... 29 3.5 >Z81571-11|CAC35914.1| 1579|Caenorhabditis elegans Hypothetical protein M01G12.12 protein. Length = 1579 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -3 Query: 361 EMSAKDRHS*INLSIRKKKRESKQHINRYIKLAMH*IENPPSLKKVKCVTSIIL*LNYW* 182 +++ K + S +NL + K +++ RYI A E+ L+K+ VTS I N+W Sbjct: 1501 KLTEKSKVSQLNLRRQDKNKKTSNSTVRYIVSASGTFESTQQLRKLVTVTSPI--KNHWE 1558 Query: 181 G 179 G Sbjct: 1559 G 1559 >AL132848-7|CAC35915.1| 1579|Caenorhabditis elegans Hypothetical protein M01G12.12 protein. Length = 1579 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -3 Query: 361 EMSAKDRHS*INLSIRKKKRESKQHINRYIKLAMH*IENPPSLKKVKCVTSIIL*LNYW* 182 +++ K + S +NL + K +++ RYI A E+ L+K+ VTS I N+W Sbjct: 1501 KLTEKSKVSQLNLRRQDKNKKTSNSTVRYIVSASGTFESTQQLRKLVTVTSPI--KNHWE 1558 Query: 181 G 179 G Sbjct: 1559 G 1559 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,434,965 Number of Sequences: 27780 Number of extensions: 236308 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -