BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0047 (337 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 0.65 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 0.86 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 6.0 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 20 6.0 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 20 8.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.4 bits (48), Expect = 0.65 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -2 Query: 312 KFSNSMKA-KPGGFSATQTEFSFPYLSNSRSRSSFLIPSTRPPTYTRVPP 166 KF S ++ KP G +T T P LSN + ++ + T +PP Sbjct: 114 KFETSFESGKPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPP 163 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 0.86 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 282 GGFSATQTEFSFPYLSNSRSRSSFLIPSTRPPTY 181 GG SA++ + + +LS+ L PS PP++ Sbjct: 93 GGISASKRQRTDDWLSSPSGNVPPLTPSPGPPSH 126 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 6.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 284 GFAFIEFENL 313 GFA ++FENL Sbjct: 1433 GFAVLDFENL 1442 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 251 LNSVWVALNPPGFAFIEFEN 310 + +VW+ + G FIEF N Sbjct: 88 VGTVWINTSINGTKFIEFIN 107 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 19.8 bits (39), Expect = 8.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 20 IGTRVSIGSVIVSLIFI 70 IGT+ +I +V S+IFI Sbjct: 236 IGTKNTIETVAYSVIFI 252 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,653 Number of Sequences: 336 Number of extensions: 1497 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6579502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -