BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0045 (494 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 0.77 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 21 7.2 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 9.5 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 24.2 bits (50), Expect = 0.77 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -2 Query: 166 TGHMMPQSNTIGRNEPRAR*VAVLSVSQTQDTTKPKVIPHNPVISVRNV 20 T M P + + PR + + + + +P+VI NPV SV V Sbjct: 548 TAKMGPSYDPMAVVSPRLKVHGIRGLRVADASVQPQVISGNPVASVNMV 596 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.0 bits (42), Expect = 7.2 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 33 LITGLCGMTFGFVVSCVCDTDRTATYLALGSFLPMVLL 146 L G G+ GF + V D T F+ M+L+ Sbjct: 98 LAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILI 135 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 20.6 bits (41), Expect = 9.5 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 Query: 182 QVHTFNGPYDAAK*HHRQERAKSQVSSCSVGVTNTGHD 69 Q HT D H E+ + SV TNTG D Sbjct: 274 QDHTLEKSNDYYAFHFEGEKGPNSQGPSSVIDTNTGVD 311 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,460 Number of Sequences: 438 Number of extensions: 3181 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -