BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0045 (494 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76150.1 68414.m08843 maoC-like dehydratase domain-containing... 31 0.56 At3g46790.1 68416.m05079 pentatricopeptide (PPR) repeat-containi... 29 1.3 At5g48050.1 68418.m05937 hypothetical protein low similarity to ... 29 2.3 At5g17910.1 68418.m02100 expressed protein 28 4.0 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 27 9.2 At3g17130.1 68416.m02186 invertase/pectin methylesterase inhibit... 27 9.2 At1g22830.1 68414.m02850 pentatricopeptide (PPR) repeat-containi... 27 9.2 >At1g76150.1 68414.m08843 maoC-like dehydratase domain-containing protein contains similarity to Swiss-Prot:P51659 estradiol 17 beta-dehydrogenase 4 (17-beta-HSD 4) (17-beta-hydroxysteroid dehydrogenase 4) [Homo sapiens]; contains Pfam profile PF01575: MaoC like domain Length = 309 Score = 30.7 bits (66), Expect = 0.56 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +3 Query: 33 LITGLCGMTFGF--VVSCVCDTDRTATYLALGSFLPMVL----LCGIIWPVEGMHLILQ 191 ++ GLC + F ++ CVC D TA G FL V L +W +EG+ +I Q Sbjct: 228 ILHGLCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMW-LEGLRVIYQ 285 >At3g46790.1 68416.m05079 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 657 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 217 RNLQSLSDRCYREVGLSMYPLSTLDSYQP 303 R LQ L RC+ EV MY ++D + P Sbjct: 517 RGLQKLPGRCWMEVRRKMYSFVSVDEFNP 545 >At5g48050.1 68418.m05937 hypothetical protein low similarity to copia-like polyprotein [Arabidopsis thaliana] GI:13872712 Length = 369 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +1 Query: 280 STLDSYQPEFG*LFI*PQVFYYLNLRKANLRSEHTLYSVLILS 408 +TL SY+ FG + I +F L+L K N L+ L LS Sbjct: 4 TTLSSYEKSFGIMQIRAYIFVTLDLNKLNYDVWRELFETLCLS 46 >At5g17910.1 68418.m02100 expressed protein Length = 1342 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 74 HDETKSHSTQSSDQCEECD 18 HDE KSHS++ SD E+ D Sbjct: 596 HDEEKSHSSEDSDFDEQAD 614 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 26.6 bits (56), Expect = 9.2 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = +3 Query: 24 FLTLITGLCGMTFGFVVSCVCDTDRTATYLALGSFLPMVLLCGIIWPVEGMHLILQWISY 203 F T I+ L + G +V V A+ L + G P MH+ L+W +Y Sbjct: 1273 FFTFISILYSIYTGIMVISVSPNQEIASILNGVISTSWNVFSGFTIPRPRMHVWLRWFTY 1332 Query: 204 ILP 212 + P Sbjct: 1333 VCP 1335 >At3g17130.1 68416.m02186 invertase/pectin methylesterase inhibitor family protein contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 183 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 122 AKSQVSSCSVGVTNTGHDETKS 57 A+ Q SC G+TN G D+ S Sbjct: 134 AEKQTDSCQKGITNAGADDESS 155 >At1g22830.1 68414.m02850 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat. Gene continues on the 3' end of BAC F19G10 gb|AF000657 gene F19G10.21 Length = 703 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 449 IYSTGLIRNMTAFRDNINTEYKVCSDLRLAFLKFK 345 I S ++ R+++ T Y CSDLR AF+ F+ Sbjct: 347 IRSCSFSHDIDNVRNSLITMYSRCSDLRHAFIVFQ 381 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,143,716 Number of Sequences: 28952 Number of extensions: 229532 Number of successful extensions: 552 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -