BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0043 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 48 1e-05 SB_7303| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43341| Best HMM Match : N_methyl (HMM E-Value=6.4) 29 4.8 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) 28 6.3 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 28 8.4 SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) 28 8.4 SB_52653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/72 (31%), Positives = 35/72 (48%) Frame = +3 Query: 408 QVIQWVQNPRTVTEAKNFEPWREKCSVEGNPACWVPHSCKLTSKEVPGETINLQTCLRCP 587 QVI+W++NP+ V A F W C P C P+ C T+ + + TC CP Sbjct: 465 QVIEWMKNPQDVNGANGFPAW--DCLTRPKPRCTTPNVCHYTTP----QDFYMPTCSDCP 518 Query: 588 VNYPWLNDPTGD 623 ++P +P G+ Sbjct: 519 KHFPSPTNPDGE 530 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 27 NPPLWPYTMYFRMPHRCHGNLQSCPTRSH-AVWEMVMNELDRREDPSNDEYLPGCAMVDS 203 NPP++PYT+ +R C + CP S+ +W V+ +D + N + G AM+D+ Sbjct: 248 NPPMYPYTLDYRSIQDC--PVGKCPVMSYPGLW--VVPNIDLMDGNGN---VCG-AMMDA 299 Query: 204 CS 209 C+ Sbjct: 300 CN 301 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 375 SHNDVYFVTMTQVIQWVQNPRTVTEAKNFEPWREKCSVEGNPACW 509 S DVYFVT++Q I+W++ P + + K F PW +C PA W Sbjct: 818 SQGDVYFVTVSQAIEWIKTPTPLEKIKTFAPW--QCDKPAPPAPW 860 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 TRITAPLSNPPLWPYTMYFRMPHRCHGNLQSCPT 104 T + +NPPLWPYT+ + C + CPT Sbjct: 728 TSMPTQQNNPPLWPYTLEYASTQEC--VIPPCPT 759 >SB_7303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 252 NFDRHYEQNRAPLGLYFHAAWLKNNPEFLEAFLYWIDEILQSHNDVYFVTMTQ 410 NF HY N+AP GL+ H+AW + +EA ++ ++ S +DV+ +T++Q Sbjct: 5 NFQYHYHSNKAPFGLHAHSAWFSQSTGHMEALRKFL-TLVASRDDVWVLTVSQ 56 >SB_43341| Best HMM Match : N_methyl (HMM E-Value=6.4) Length = 247 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = -1 Query: 474 LSTARSSWLQSRYVGFVPIGSLVSW*RSKRRCGFEGSRLSNTRKLPKIQGCFSTKLHGNK 295 ++T S W +S+ + V+ R C F S+ + + LP I+G FS + Sbjct: 20 IATTESIW-KSKVIRLPRESDAVTTKREFAFCAFVSSKTTFPQNLPYIEGVFSDTCFALR 78 Query: 294 VLKVLGSVRNDGQS 253 +L GS +S Sbjct: 79 LLDTTGSTTQQFKS 92 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 402 MTQVIQWVQNPRTVTEAKNFEPWREKCSVEGNPACWVPHSCKLTSKEVPG 551 + QVI + ++P ++ P+ +V G P C +C TSK V G Sbjct: 3934 LVQVIIFGRDPCYASDCAEKRPYSTCQAVNGQPTCVCNKNCPSTSKPVCG 3983 >SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) Length = 1860 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 93 SCPTRSHAVWEMVMNELDRREDPSNDEYLPGC 188 SC T S+ + + ++N +DR P +D YL C Sbjct: 1113 SCLTWSNLISQELLNSIDRTIKPCDDFYLYAC 1144 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 502 AGFPSTEHFSLHGSKFLASVTVRGFCTHWITCVM 401 AG P+T HF LHG+ +++ G T +T +M Sbjct: 1132 AGPPNTSHFGLHGASTISTTLTPGQST-TLTIIM 1164 >SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) Length = 702 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 518 FLQAHFKGSSRRNHQFTNLFEMPSQLPLVK----RPHGRWPLLRSHDLEPH 658 F +AHF+ + + F P Q P + PH + P R+ EPH Sbjct: 329 FSEAHFQSPTSNSLFQRPTFRAPHQTPFFRAPLSEPHSQSPTFRAPQSEPH 379 >SB_52653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 369 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +3 Query: 402 MTQVIQWV-QNPR---TVTEAKNFEPWREK 479 + ++ QW+ QNPR ++ +N+EPW E+ Sbjct: 151 LKEIDQWLNQNPREIVVISFTRNYEPWNER 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,945,268 Number of Sequences: 59808 Number of extensions: 579145 Number of successful extensions: 1564 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -