BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0042 (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 2.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.8 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 81 KLNVETAEKAIMEEVKANKERKQTTRSRGDTPS 179 K+N K E K++ +RKQ D+P+ Sbjct: 190 KINYNPFAKGFRENGKSSAKRKQLVSEHPDSPN 222 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 108 LSRRFQRSASGSCC*CTRCSVWTSLQP 28 L + F++ S SC RC +W+ P Sbjct: 35 LCQSFRKQNSSSCGNGNRCDLWSEKFP 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,047 Number of Sequences: 336 Number of extensions: 1948 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -