BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0036 (329 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 0.56 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 24 1.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 2.3 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 3.9 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 3.9 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 3.9 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 3.9 AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding pr... 23 3.9 AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding pr... 23 3.9 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 22 6.9 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 152 GTSSVEVTLKVYDKPSKPEGPVIMREISRESVTIEWKPPL 271 G S + T+KV KP + ++S S+T+ W PP+ Sbjct: 291 GKLSEKATVKV--KPEDVPLNLRAHDVSTHSMTLSWAPPI 328 Score = 25.0 bits (52), Expect = 0.74 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 4/77 (5%) Frame = +2 Query: 101 LKRSHSSKYTIEASNTAGTSSVEVTLKVYDKPSKPEGP---VIMREISRESVTIEWKPPL 271 L+R ++ + N G E + P GP + +R + + V I W+PP Sbjct: 78 LERGVEYEFRVAGMNHIGIGQ-EAVKHLQTPEGSPTGPPTGIAVRFQTPDVVCITWEPPT 136 Query: 272 -DDGGLELTKYAIEKHE 319 + ++T+Y ++ H+ Sbjct: 137 REHRNGQITRYDVQFHK 153 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 324 SGSCFSMAYFVSSRPPSSKGGFHSI 250 SGSC S +Y P S+ GF S+ Sbjct: 43 SGSCLSFSYKCVPVPASASEGFISV 67 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 115 MRALQFLIRITLVFSFVVILYSL 47 +RA+ L+ I L+ FV+I+Y++ Sbjct: 240 LRAMVPLLHIALLVLFVIIIYAI 262 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 322 GFMFFDGVFC 293 GF+F DG FC Sbjct: 912 GFLFHDGAFC 921 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 93 PQLRKTRD----QTYVYLNRHACLLNT 115 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 93 PQLRKTRD----QTYVYLNRHACLLNT 115 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 170 PQLKKFQRYWKLQ*YIYLNESASILNS 90 PQL+K + Q Y+YLN A +LN+ Sbjct: 104 PQLRKTRD----QTYVYLNRHACLLNT 126 >AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding protein AgamOBP57 protein. Length = 190 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 248 TIEWKPPLDDGGLE 289 TIEWK PL +G ++ Sbjct: 102 TIEWKVPLAEGFIQ 115 >AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding protein OBP14426 protein. Length = 204 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 248 TIEWKPPLDDGGLE 289 TIEWK PL +G ++ Sbjct: 116 TIEWKVPLAEGFIQ 129 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 297 FVSSRPPSSKGGFHSI 250 F+ PP S G FH I Sbjct: 386 FILLGPPGSHGSFHEI 401 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 263,668 Number of Sequences: 2352 Number of extensions: 3766 Number of successful extensions: 63 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22910151 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -