BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0035 (518 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0124 + 18232961-18236636,18236810-18237288,18237549-182376... 27 6.8 05_04_0122 + 18198594-18202269,18202551-18202591,18203273-182032... 27 6.8 >05_04_0124 + 18232961-18236636,18236810-18237288,18237549-18237629, 18238033-18238041,18238096-18238248 Length = 1465 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 86 GMSDTNKEHFLIRHILKYFSLNFLYINVVGFGFP 187 G +DT EH L H+L + SL L++ GF P Sbjct: 940 GSTDTKDEHILPDHLLSWGSLTKLHLQ--GFNTP 971 >05_04_0122 + 18198594-18202269,18202551-18202591,18203273-18203281, 18203336-18203551,18204257-18204361,18204761-18204919 Length = 1401 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 86 GMSDTNKEHFLIRHILKYFSLNFLYINVVGFGFP 187 G +DT EH L H+L + SL L++ GF P Sbjct: 940 GSTDTKDEHILPDHLLSWGSLTKLHLQ--GFNTP 971 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,650,513 Number of Sequences: 37544 Number of extensions: 260008 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -