BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0035 (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC004213-1|AAH04213.1| 223|Homo sapiens proteasome (prosome, ma... 30 5.6 BC004184-1|AAH04184.1| 223|Homo sapiens proteasome (prosome, ma... 30 5.6 BC002383-1|AAH02383.1| 223|Homo sapiens proteasome (prosome, ma... 30 5.6 >BC004213-1|AAH04213.1| 223|Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 protein. Length = 223 Score = 29.9 bits (64), Expect = 5.6 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 9 TVIVRRENADLTFELVPKPWAKPGLLGCQI 98 TVI R E L LVP WA GLLGC I Sbjct: 191 TVIRRGEKHQL--RLVPTRWAGKGLLGCNI 218 >BC004184-1|AAH04184.1| 223|Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 protein. Length = 223 Score = 29.9 bits (64), Expect = 5.6 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 9 TVIVRRENADLTFELVPKPWAKPGLLGCQI 98 TVI R E L LVP WA GLLGC I Sbjct: 191 TVIRRGEKHQL--RLVPTRWAGKGLLGCNI 218 >BC002383-1|AAH02383.1| 223|Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 protein. Length = 223 Score = 29.9 bits (64), Expect = 5.6 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 9 TVIVRRENADLTFELVPKPWAKPGLLGCQI 98 TVI R E L LVP WA GLLGC I Sbjct: 191 TVIRRGEKHQL--RLVPTRWAGKGLLGCNI 218 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,186,757 Number of Sequences: 237096 Number of extensions: 1554205 Number of successful extensions: 2193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2193 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -