BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0034 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 54 8e-08 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 54.4 bits (125), Expect = 8e-08 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +2 Query: 536 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQI 643 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAI 36 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 515 HHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNP 655 HH+ T+ I + T+I PT I + + +H T IN +P Sbjct: 14 HHLHTIIIHLHPTVIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHP 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,890,245 Number of Sequences: 59808 Number of extensions: 229241 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -