BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0026 (343 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 4.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 4.1 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 5.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 5.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 5.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 5.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 5.4 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 20 7.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 20 7.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 20 7.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 20 7.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 20 7.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 20 7.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 20 9.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 20 9.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 9.5 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.0 bits (42), Expect = 4.1 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 25 IPGLQEFGTRHDRSPLQE 78 + G+Q++GT+ ++PL E Sbjct: 19 VHGIQKWGTQFGQAPLLE 36 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 4.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R++ P + +E Sbjct: 362 PVPVPVPIYCGNFPPRSMEPWISMQE 387 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 257 NHRTWVYYPLPVPVSVQLTPLVARALRPSVRSKE 156 N+ + P+PVPV V R++ P + +E Sbjct: 106 NYIEQIPVPVPVPVPVYYGNFPPRSMGPWISIQE 139 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 257 NHRTWVYYPLPVPVSVQLTPLVARALRPSVRSKE 156 N+ + P+PVPV V R++ P + +E Sbjct: 106 NYIEQIPVPVPVPVPVYYGNFPPRSMGPWISIQE 139 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 5.4 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -3 Query: 257 NHRTWVYYPLPVPVSVQLTPLVARALRPSVRSKE 156 N+ + P+P+PV V + R + P + +E Sbjct: 106 NYIEQIPVPVPIPVPVYYGNFLPRPMGPWISIQE 139 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 257 NHRTWVYYPLPVPVSVQLTPLVARALRPSVRSKE 156 N+ + P+PVPV V R++ P + +E Sbjct: 106 NYIEQIPVPVPVPVPVYYGNFPPRSMGPWISIQE 139 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 5.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 281 PGDVGDGQYLKKKSNNSRLR 340 PGD DG+YL S +R Sbjct: 149 PGDDYDGKYLVLPSGELHIR 168 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 257 NHRTWVYYPLPVPVSVQLTPLVARALRPSVRSKE 156 N+ + P+PVPV V R++ P + +E Sbjct: 339 NYIEQIPVPVPVPVPVYYGNFPPRSMGPWISIQE 372 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R L P + +E Sbjct: 122 PIPVPVPIYCGNFPPRPLGPWISIQE 147 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R L P + +E Sbjct: 122 PIPVPVPIYCGNFPPRPLGPWISIQE 147 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R L P + +E Sbjct: 122 PIPVPVPIYCGNFPPRPLGPWISIQE 147 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R L P + +E Sbjct: 122 PIPVPVPIYCGNFPPRPLGPWISIQE 147 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 120 PVPVPVPIYCGNFPSRPMGPWVPMQE 145 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.2 bits (40), Expect = 7.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + +R + P V +E Sbjct: 123 PVPVPVPIYCGNFPSRPMGPWVPMQE 148 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 19.8 bits (39), Expect = 9.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV V R + P + +E Sbjct: 123 PVPVPVPVYCGNFPPRPMGPWISMQE 148 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 19.8 bits (39), Expect = 9.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV V R + P + +E Sbjct: 123 PVPVPVPVYCGNFPPRPMGPWISMQE 148 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.8 bits (39), Expect = 9.5 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 233 PLPVPVSVQLTPLVARALRPSVRSKE 156 P+PVPV + R + P + +E Sbjct: 337 PIPVPVPIYCGNFPPRPMGPWISMQE 362 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,417 Number of Sequences: 438 Number of extensions: 2147 Number of successful extensions: 23 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -