BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0018 (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 3.7 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 23 3.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.5 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 8 LLSLCGFVINLIQKWC 55 L+ C FV+ L QK+C Sbjct: 181 LIQFCAFVVVLKQKFC 196 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 8 LLSLCGFVINLIQKWC 55 L+ C FV+ L QK+C Sbjct: 6 LIQFCAFVVVLKQKFC 21 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 645 IAGMTLLEYWNGLLSVLTESYFCSMLTNLIY 737 I G+ L+Y + FC+++T L+Y Sbjct: 385 IFGLVNLKYRETYFRLSKTKTFCTLVTALVY 415 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,985 Number of Sequences: 336 Number of extensions: 3768 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -