BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0017 (575 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 5.7 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 5.7 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 9.9 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -3 Query: 51 LVPNSCSPGIH 19 LVP +C+PG+H Sbjct: 1229 LVPQNCAPGLH 1239 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 5.7 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 Query: 382 WCDHYVFTPSTQPNTPKDRIYKLPDLQGLSPSLGVGAVGMPGATAYFGFLEICKPK 549 WCD + + NTP ++ K+ ++ S AV +P A Y F+ I K Sbjct: 19 WCDQTIGLITFDINTPSFKLSKIRSFLNITAS----AVLLPFA-IYHIFMHIVPTK 69 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 511 TAYFGFLEICKPKAGE 558 T FGFL +C + G+ Sbjct: 22 TKIFGFLPVCSSQKGQ 37 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 562 RSRQLLACRFLRNQNRQSRPASQPPLRPATAT 467 R +LLA +R +PA++ RPA A+ Sbjct: 233 RKSELLAGLQSSGSSRSHQPATKSKPRPAPAS 264 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 535 FLRNQNRQSRPASQPP 488 FL++ NR +RPA+ P Sbjct: 706 FLKSGNRLARPANCSP 721 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 401 SLLVRNLTLQRIVFI 445 ++L++N+TL +VFI Sbjct: 77 NILMKNVTLNDVVFI 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,854 Number of Sequences: 336 Number of extensions: 3000 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -