BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0016 (603 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 22 3.5 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 8.0 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 22.2 bits (45), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 411 FIRGLSENTLYFPSISISQVNSYPPISFSK 322 FI G+ N YFP N Y P + +K Sbjct: 88 FIYGMHHNEKYFPEPEKFDPNRYLPENQAK 117 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 150 LLIRLFVHSSSLREHFPRVSTN 85 ++I L+ HSS RE+F S N Sbjct: 35 IIIALYAHSSYGRENFIYGSMN 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,057 Number of Sequences: 336 Number of extensions: 3037 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -