BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0015 (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60380.1 68416.m06753 expressed protein 33 0.11 At1g55820.1 68414.m06400 hydroxyproline-rich glycoprotein family... 31 0.59 At5g22355.1 68418.m02608 DC1 domain-containing protein contains ... 29 3.1 At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative ... 28 4.1 At5g16630.1 68418.m01947 DNA repair protein Rad4 family low simi... 28 5.5 At2g36240.1 68415.m04448 pentatricopeptide (PPR) repeat-containi... 28 5.5 At3g51240.1 68416.m05609 naringenin 3-dioxygenase / flavanone 3-... 27 7.2 >At3g60380.1 68416.m06753 expressed protein Length = 743 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 377 PQPFKSQPRYTHIVYNVPTA-PPLSLTNAQKFVNSYIPNRRTVQPIQAEPTQNYFTPAQF 553 P P++++P I N P+ P+S+ K ++S + Q A QN F+P++ Sbjct: 254 PVPWQARPEMMGIGDNYPSNFQPISVDETLKSISSRSTGSSSSQTSYASQNQNRFSPSRS 313 Query: 554 LSSQSL 571 +S++SL Sbjct: 314 VSAESL 319 >At1g55820.1 68414.m06400 hydroxyproline-rich glycoprotein family protein Length = 575 Score = 31.1 bits (67), Expect = 0.59 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 403 IHAYRIQRSNCSSSIFNQCSKIRQLLHTKPTNSSANTGRTHPKLFHTSPILKFSKPT 573 IH + S F Q + + H KP +++ N T+P L HTSP++ S P+ Sbjct: 407 IHQFLSPNGIPQQSYFPQGAALTAPSHAKPVDNTENPPTTNPYL-HTSPMVASSIPS 462 >At5g22355.1 68418.m02608 DC1 domain-containing protein contains Pfam PF03107: DC1 domain; similar to ULI3 [Arabidopsis thaliana] GI:17225050 Length = 664 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 436 SSSIFNQCSKIRQLLHTKPTNSSANTGRTHPKLFHTSPILKFSKPTR 576 S I+N C + R +LH K AN + +FHT P +S+P R Sbjct: 407 SDPIYN-CEECRFILHEK----CANHPKKKRHVFHTKPFTLWSRPPR 448 >At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative similar to GTL1 [Arabidopsis thaliana] GI:2664198 Length = 669 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 341 SNDAPDPNAQWRPQP-FKSQPRYTHIVYNVPTAPPLSL 451 S+ +P P +PQP ++QP TH V PT PPL L Sbjct: 172 SSSSPFPVFS-QPQPQTQTQPPQTHNVSFTPTPPPLPL 208 >At5g16630.1 68418.m01947 DNA repair protein Rad4 family low similarity to SP|Q01831 DNA-repair protein complementing XP-C cells (Xeroderma pigmentosum group C complementing protein) {Homo sapiens}; contains Pfam profile PF03835: DNA repair protein Rad4 Length = 865 Score = 27.9 bits (59), Expect = 5.5 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 430 NCSSSIFNQCSKIRQLLHTKPTNSSANTGRTHPKLFHTSPILKFSKPTRCWSEIFCS 600 N SS N K+R++ TK +NSS+ + + F + K P CW E++C+ Sbjct: 365 NQQSSQVNNTKKVREI--TKISNSSSVSDQVISTAFGSK---KVDSPL-CWLEVYCN 415 >At2g36240.1 68415.m04448 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 379 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 44 DLLCSRKRPSEFDYRNF-DVTCERNKGLKRM 133 DLL R PSEFDY + + C NK ++ M Sbjct: 205 DLLNKRVLPSEFDYGSLVEKLCGENKAVRAM 235 >At3g51240.1 68416.m05609 naringenin 3-dioxygenase / flavanone 3-hydroxylase (F3H) identical to GI:3790548 Length = 358 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 461 EHWLKIEEEQLERCIRYACIEVEI*RAGVSIERWGL 354 E W+K+ EE ER + AC +E+ + +E+ L Sbjct: 151 EGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESL 186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,842,662 Number of Sequences: 28952 Number of extensions: 257018 Number of successful extensions: 739 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -