BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0014 (579 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7TCJ4 Cluster: Predicted protein; n=1; Nematostella ve... 33 4.9 UniRef50_Q0TCJ1 Cluster: Putative uncharacterized protein; n=1; ... 32 8.5 >UniRef50_A7TCJ4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 214 Score = 33.1 bits (72), Expect = 4.9 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -3 Query: 229 PTNFCYIFKLNCISYYRKKWTRHLNNYLFNFFQHRNVIIIMYRL 98 P N YI I ++ R L+++L NF+ NVI I YRL Sbjct: 11 PPNTAYIHHYTNIGCFQDNGRRALSHHLGNFYGKSNVIAICYRL 54 >UniRef50_Q0TCJ1 Cluster: Putative uncharacterized protein; n=1; Escherichia coli 536|Rep: Putative uncharacterized protein - Escherichia coli O6:K15:H31 (strain 536 / UPEC) Length = 69 Score = 32.3 bits (70), Expect = 8.5 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 314 RFLCLKIVCIN*HTNEFSSKLY--NFIGINYFYEFWELQLRCH 436 R +C K C+N ++SS Y +F+ + YE+W L+ H Sbjct: 13 RVICPKRQCVNSQKEKYSSLSYKLSFVDVRNSYEYWRLKAHKH 55 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,304,428 Number of Sequences: 1657284 Number of extensions: 7984692 Number of successful extensions: 15493 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15492 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39987623712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -