BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0014 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.19c ||SPAC683.01c|transcription factor, zf-fungal binuc... 28 0.86 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.1 >SPAC25B8.19c ||SPAC683.01c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 522 Score = 28.3 bits (60), Expect = 0.86 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 565 SSQSATRFSSYSGASVKTTVDLYISIGNSNFNNHTLSR 452 +S+S+T S+ S T+ + + + N NNHTLSR Sbjct: 350 ASESSTSQSNDSQGPANTSYPVSVPLPNDAENNHTLSR 387 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 27.9 bits (59), Expect = 1.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -3 Query: 238 SNVPTNFCYIFKLNCISYYRKKWTRHLNNYLFNFFQHRNVIII 110 SNV FC+ F + S++ +T N+ F +H++++ I Sbjct: 102 SNVVPFFCFFFYFSLFSFFSFLFTSLHFNFFFRLCRHKHLLDI 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,091,218 Number of Sequences: 5004 Number of extensions: 38446 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -