BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0013 (664 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64849-2|AAC48051.1| 411|Caenorhabditis elegans Hypothetical pr... 29 3.9 Z83234-6|CAB05770.2| 414|Caenorhabditis elegans Hypothetical pr... 28 6.8 Z83232-2|CAB05754.2| 420|Caenorhabditis elegans Hypothetical pr... 27 9.0 >U64849-2|AAC48051.1| 411|Caenorhabditis elegans Hypothetical protein K04A8.5 protein. Length = 411 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 427 YQDYYNYHALKDRVFNSRKRIKKIVKY*CSI 519 Y++Y H D +F S KKIVKY C + Sbjct: 227 YEEYVKKHG-SDELFGSSLLFKKIVKYTCGL 256 >Z83234-6|CAB05770.2| 414|Caenorhabditis elegans Hypothetical protein K09E4.5 protein. Length = 414 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 99 ILIHFLNAYVFEMRYF 146 ILIH+ NA + EMRYF Sbjct: 221 ILIHYTNATMLEMRYF 236 >Z83232-2|CAB05754.2| 420|Caenorhabditis elegans Hypothetical protein K04B12.2a protein. Length = 420 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -1 Query: 202 CATRKELSQI*LVLLMKSMKYRISNTYAFKKCINMRHFNPENTLN*IKTR 53 C RK + + M R NTY F++ +NMR + + TL +++R Sbjct: 6 CRVRKSERYQHQIQKSRKMADRSRNTYRFERLMNMRLTSIDETLRALESR 55 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,533,488 Number of Sequences: 27780 Number of extensions: 254893 Number of successful extensions: 500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -