BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0010 (304 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 68 1e-12 At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 65 7e-12 At4g18300.1 68417.m02715 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 47 3e-06 At2g34970.1 68415.m04291 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 40 2e-04 At1g77840.1 68414.m09070 eukaryotic translation initiation facto... 39 7e-04 At5g44860.1 68418.m05499 expressed protein strong similarity to ... 27 1.8 At1g03080.1 68414.m00282 kinase interacting family protein simil... 27 2.4 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 3.2 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 3.2 At4g19950.1 68417.m02922 expressed protein 27 3.2 At2g23000.1 68415.m02743 serine carboxypeptidase S10 family prot... 26 4.2 At1g31130.1 68414.m03809 expressed protein 26 4.2 At1g30240.1 68414.m03699 PELP1-related contains weak similarity ... 26 4.2 At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase... 25 7.4 At5g10500.1 68418.m01216 kinase interacting family protein simil... 25 7.4 At4g24510.1 68417.m03514 eceriferum protein (CER2) identical to ... 25 7.4 At2g31760.1 68415.m03878 zinc finger protein-related contains lo... 25 7.4 At1g31300.1 68414.m03830 expressed protein similar to hypothetic... 25 7.4 At3g55940.1 68416.m06216 phosphoinositide-specific phospholipase... 25 9.7 At3g52910.1 68416.m05831 expressed protein nearly identical to t... 25 9.7 At3g13100.1 68416.m01640 ABC transporter family protein similar ... 25 9.7 At2g23010.2 68415.m02745 serine carboxypeptidase S10 family prot... 25 9.7 At2g23010.1 68415.m02744 serine carboxypeptidase S10 family prot... 25 9.7 At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila... 25 9.7 >At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 67.7 bits (158), Expect = 1e-12 Identities = 28/70 (40%), Positives = 47/70 (67%) Frame = +1 Query: 10 RAELALLTKVQEYCYENMSFMRAFSKLVVMLYKTSVLSEEVILKWYKDTSSSKGKVMFLD 189 + EL L+ KVQ CYE+ M+ F ++V LY+ VL+E+ IL W++ ++SKG+ F+ Sbjct: 336 KLELELMYKVQMQCYEDAKLMKVFPEVVRSLYELDVLAEDTILHWFRKGTNSKGRQTFVK 395 Query: 190 QMKKFVDWLQ 219 ++ FV+WL+ Sbjct: 396 SLEPFVNWLE 405 >At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|P47823 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Oryctolagus cuniculus}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 65.3 bits (152), Expect = 7e-12 Identities = 27/68 (39%), Positives = 45/68 (66%) Frame = +1 Query: 16 ELALLTKVQEYCYENMSFMRAFSKLVVMLYKTSVLSEEVILKWYKDTSSSKGKVMFLDQM 195 E+ L+ KVQ CYE+ M+ F ++V LY+ VL+E+ IL WY+ ++ KG+ F+ + Sbjct: 338 EMELMYKVQMQCYEDAKLMKVFPEVVRSLYELDVLAEDTILHWYRKGTNPKGRQTFVKGL 397 Query: 196 KKFVDWLQ 219 + FV+WL+ Sbjct: 398 EPFVNWLE 405 >At4g18300.1 68417.m02715 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q64350 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Rattus norvegicus}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 709 Score = 46.8 bits (106), Expect = 3e-06 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +1 Query: 7 TRAELALLTKVQEYCYENMSFMRAFSKLVVMLYKTSVLSEEVILKWYKDTSSSKG-KVMF 183 T A++ ++ K +E C E+ F+KL+ LY V+ E+ IL+W ++ + + ++ Sbjct: 628 TDAQIEVIMKFEEMCQESEELSPLFAKLLPFLYDKDVVQEDAILRWGEEKAGADDCDKVY 687 Query: 184 LDQMKKFVDWLQ 219 L++ + F+ WL+ Sbjct: 688 LNKCESFIKWLK 699 >At2g34970.1 68415.m04291 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q64350 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Rattus norvegicus}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 730 Score = 40.3 bits (90), Expect = 2e-04 Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 16 ELALLTKVQEYCYENMSFMRA-FSKLVVMLYKTSVLSEEVILKWYKD-TSSSKGKVMFLD 189 ++ ++ K +E C E+ + F++++ +LY VL E+ IL+W ++ + + ++L Sbjct: 642 QIEVIMKFEEMCQESHKELGPLFTQILHLLYDKDVLQEDAILRWEEEKAGADEADKVYLK 701 Query: 190 QMKKFVDWLQ 219 Q F+ WL+ Sbjct: 702 QCDTFIQWLK 711 >At1g77840.1 68414.m09070 eukaryotic translation initiation factor 5, putative / eIF-5, putative similar to SP|P55876 Eukaryotic translation initiation factor 5 (eIF-5) {Zea mays}; contains Pfam profiles PF02020: eIF4-gamma/eIF5/eIF2-epsilon, PF01873: Domain found in IF2B/IF5 Length = 437 Score = 38.7 bits (86), Expect = 7e-04 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 4/74 (5%) Frame = +1 Query: 13 AELALLTKVQEYCYENMS--FMRAFSKLVVMLYKTSVLSEEVILKWYKD--TSSSKGKVM 180 +++ LL + +C +N + ++ + ++ LY ++ EEV+L WY+ T + K + Sbjct: 356 SQMHLLNSIGTFCGKNGNEEALKEVALVLKALYDQDIIEEEVVLDWYEKGLTGADKSSPV 415 Query: 181 FLDQMKKFVDWLQN 222 + +K FV+WLQ+ Sbjct: 416 W-KNVKPFVEWLQS 428 >At5g44860.1 68418.m05499 expressed protein strong similarity to unknown protein (gb AAC79135.1) Length = 321 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 240 LRLLFSILEPVYKLLHLVKEHDLALGRTSV 151 L + S+LEP+Y + + K ++L GRT++ Sbjct: 190 LASVVSVLEPIYGIAAMKKSYELLNGRTNM 219 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 132 HLLREDARLVQHYHQLTERAHEAHVLVAVL 43 HL E+ V+ Y +RAH+AH+ + VL Sbjct: 854 HLQDENQCRVREYQVELDRAHDAHIEIIVL 883 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 3.2 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = -3 Query: 188 SRNMTLPLEELVSLYHLRI--TSSERTLVLYSITTSLLNARMKLMFS*QYSWTLVSRASS 15 S ++ L L LR+ S E+TL YS L++ L ++ W V R+ S Sbjct: 837 SARLSSGLSALAHPLKLRLCRASGEKTLRDYSSNIVLIDPLASLAAVEEFLWPRVQRSES 896 Query: 14 ALVP 3 AL P Sbjct: 897 ALKP 900 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 3.2 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = -3 Query: 188 SRNMTLPLEELVSLYHLRI--TSSERTLVLYSITTSLLNARMKLMFS*QYSWTLVSRASS 15 S ++ L L LR+ S E+TL YS L++ L ++ W V R+ S Sbjct: 910 SARLSSGLSALAHPLKLRLCRASGEKTLRDYSSNIVLIDPLASLAAVEEFLWPRVQRSES 969 Query: 14 ALVP 3 AL P Sbjct: 970 ALKP 973 >At4g19950.1 68417.m02922 expressed protein Length = 321 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 240 LRLLFSILEPVYKLLHLVKEHDLALGRT 157 L + S+LEP+Y L + K ++L G+T Sbjct: 190 LASVVSVLEPIYGLAAMKKSYELLKGKT 217 >At2g23000.1 68415.m02743 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 437 Score = 26.2 bits (55), Expect = 4.2 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 111 RLVQHYHQLTERAHEAHVLV 52 RLV+ YH+ T++ + H+L+ Sbjct: 259 RLVEEYHKCTDKINTQHILI 278 >At1g31130.1 68414.m03809 expressed protein Length = 321 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -2 Query: 231 LFSILEPVYKLLHLVKEHDLALGRTSVFVPL 139 + S+LEPVY + + K ++L G+T + + L Sbjct: 193 VISVLEPVYGIAAMRKAYELLKGKTKMAMGL 223 >At1g30240.1 68414.m03699 PELP1-related contains weak similarity to PELP1 [Homo sapiens] gi|21426922|gb|AAC17708 Length = 873 Score = 26.2 bits (55), Expect = 4.2 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = -3 Query: 158 LVSLYHLRITSSERTLVLYSITTSLLNARMKLMFS*QYSWTLVSRAS 18 LVS Y + + E + LYSITT+LL + M + + Q + +V AS Sbjct: 454 LVSSYFRKCSLPELRIKLYSITTTLLKS-MGIGMAMQLAQEVVINAS 499 >At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase C (PLC1) identical to phosphoinositide specific phospholipase C [Arabidopsis thaliana] GI:902923 Length = 561 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 216 EPVYKLLHLVKEHDLALGRTSVFVPLEDHL 127 E + K L++VKE+ + V + LEDHL Sbjct: 174 EDLQKCLNVVKENAFQVSAYPVVLTLEDHL 203 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -2 Query: 138 EDHLLREDARLVQHYHQLTERAHEAHVLVAVLLDLSEQGE 19 E HLL E +++++Y ++ + HE + + L ++G+ Sbjct: 555 EKHLLTEYTKVLRNYKEVKKLLHETETKLKNVNTLKDEGK 594 >At4g24510.1 68417.m03514 eceriferum protein (CER2) identical to (CER2) [Arabidopsis thaliana] GI:1213594; contains Pfam profile PF02458: Transferase family Length = 421 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 209 STNFFIWSRNMTLPLEELVSLYHLRITSSERTLVLYSI 96 S++FF + N+T + + +Y L I + V Y+I Sbjct: 342 SSDFFTYGANLTFVNLDEIDMYELEINGGKPDFVNYTI 379 >At2g31760.1 68415.m03878 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 514 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +1 Query: 55 ENMSFMRAFSKLVVMLYKTSVLSEEVILKWYKDTSSSKGKVMFLDQMKKFV 207 E+ ++ A +++ ++ EE ILK +D ++FL Q++ V Sbjct: 25 ESYNYNAAVDTIILSEKSYVIIKEEEILKLQRDDIERVSTILFLSQVEAIV 75 >At1g31300.1 68414.m03830 expressed protein similar to hypothetical protein GB:AAF24587 GI:6692122 from [Arabidopsis thaliana] Length = 278 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 97 MLYKTSVLSEEVILKWYKDTSSSKGKVMF-LDQMKKFVDWL 216 M+ + + + E+ L+WY DT+ K + + ++ + F+ WL Sbjct: 174 MVLISEITTPEINLRWYLDTAGMKKSLAYVVNGVFIFLAWL 214 >At3g55940.1 68416.m06216 phosphoinositide-specific phospholipase C, putative similar to phosphoinositide specific phospholipase C GI:857374 from [Arabidopsis thaliana] Length = 584 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 237 RLLFSILEPVYKLLHLVKEHDLALGRTSVFVPLEDHL 127 R L S +E + K L ++EH + V V LEDHL Sbjct: 166 RTLTSPVELI-KCLRAIREHAFDVSDYPVVVTLEDHL 201 >At3g52910.1 68416.m05831 expressed protein nearly identical to transcription activator GRL4 [Arabidopsis thaliana] GI:21539886 (unpublished) Length = 548 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 203 NFFIWSRNMTLPLEELVSLYHLRITSSERTLVLYSITTSLLN 78 NFF W++ L L+ L+ Y L S + L+L I SLL+ Sbjct: 81 NFFSWAQWQELELQALIYRYMLAGASVPQELLL-PIKKSLLH 121 >At3g13100.1 68416.m01640 ABC transporter family protein similar to ATP-binding cassette transporter MRP8 GI:18031899 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1493 Score = 25.0 bits (52), Expect = 9.7 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = -2 Query: 282 LTRCTYLLIFFFSALRLLFSILEPVYKLLHLVKEHDLALGRTSVFVPL 139 L R ++L F FS RLL I +YK LV H L +V V L Sbjct: 137 LLRVWWVLYFMFSCYRLLVDI--ALYKKQELVSVHLLLSDVLAVSVGL 182 >At2g23010.2 68415.m02745 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 437 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 111 RLVQHYHQLTERAHEAHVLVAVLLDLSEQ 25 +LV+ YH+ T+ + H L+A D + Q Sbjct: 259 KLVEEYHKCTDNINSHHTLIANCDDSNTQ 287 >At2g23010.1 68415.m02744 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 437 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 111 RLVQHYHQLTERAHEAHVLVAVLLDLSEQ 25 +LV+ YH+ T+ + H L+A D + Q Sbjct: 259 KLVEEYHKCTDNINSHHTLIANCDDSNTQ 287 >At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar to RNA helicase GI:3776027 from [Arabidopsis thaliana] Length = 513 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = -2 Query: 240 LRLLFSILEPVYK---LLHLVKEHDLALGRTSVFVPLEDHL 127 L+L F + P K LL+LV+EH + +T +FV + H+ Sbjct: 244 LKLSFLTVRPEEKYSALLYLVREHISSDQQTLIFVSTKHHV 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,437,280 Number of Sequences: 28952 Number of extensions: 96120 Number of successful extensions: 290 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -