BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0003 (342 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 30 0.56 SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 28 2.3 SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_49672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.0 SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 27 4.0 SB_51461| Best HMM Match : DRMBL (HMM E-Value=2.6) 27 5.3 SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 27 5.3 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 27 5.3 SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) 26 7.0 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 26 7.0 SB_28992| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) 26 7.0 SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_40852| Best HMM Match : SURF6 (HMM E-Value=3.8) 26 9.2 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 29.9 bits (64), Expect = 0.56 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +3 Query: 78 AMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPXKSVVLSAFSVLPPLAQLALASDG 245 +MAAV + +L+ + + + ++KNN +S+ AF+ L L L L+S+G Sbjct: 36 SMAAVCRPAGLLEPDHFALPVAVESLILKNNSIRSIAKGAFNGLDKLLTLDLSSNG 91 >SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 28.7 bits (61), Expect = 1.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 86 CHCRDGDSKQTNDCL 42 CHCRDG+S Q N+ + Sbjct: 336 CHCRDGESVQVNNAM 350 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +3 Query: 63 TIAIAAMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPXKSVVLSAFSVLPPLA 221 T I MA T+ + V + G +F A T+V ++ +V + + SVLPP A Sbjct: 430 TGTIENMAQFTSQAPVAEAGTPSFVAAS-TDVTQSTTIATVNIKSASVLPPTA 481 >SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +3 Query: 159 VKNNPXKSVVLSAFSVLPPLAQLALASDGETHEELLKAIGFPDDDAI 299 ++ P S VLS S PPL + + T + + I PD++A+ Sbjct: 221 IELGPQSSGVLSLTSDPPPLEAMGKEGEAHTDSGVEEEIDIPDEEAV 267 >SB_49672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 3.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 H+ L + ER+ ++PK PR +F Sbjct: 21 HENLSINERDSSSPKRPRQHQF 42 >SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 27.1 bits (57), Expect = 4.0 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 2/89 (2%) Frame = +3 Query: 15 IRETQATNMKTI-ICLFTIAIAAMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPXKSVVL 191 IR Q TN + + + +A M + N+ N TAR + ++ ++V+ Sbjct: 53 IRFLQTTNSTIVDMSMSAVANCCMFDESRKENLTSTSILNRTARALANLAEDEK-NAIVI 111 Query: 192 SAFSVLPPLAQLAL-ASDGETHEELLKAI 275 + L +L ASD E E +L+A+ Sbjct: 112 EELGAIEELTKLLTDASDTECQESVLRAL 140 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 27.1 bits (57), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 134 EVIVSIFEHIREICDGCH 81 +VI++ +EH + CDGCH Sbjct: 356 DVIIARYEHNKCRCDGCH 373 >SB_51461| Best HMM Match : DRMBL (HMM E-Value=2.6) Length = 455 Score = 26.6 bits (56), Expect = 5.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -2 Query: 164 FHYFGKHSGCEVIVSIFEHIREICDGCHCRDGDSKQTNDCLHVCG 30 FH G + E+ S F + E+ D C GD + + C H G Sbjct: 294 FHAIGDY---EMFDSCFHMLYEMFDSCFHTIGDYVRIDSCFHTIG 335 >SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 212 RQHRKCREDNAFPWIIFHYFGKHS 141 R HR+CR N W H FG H+ Sbjct: 291 RAHRRCRRQNGKRW---HAFGTHT 311 >SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 1188 Score = 26.6 bits (56), Expect = 5.3 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = +3 Query: 9 RDIRETQATNMKTIICLFTIAIAAMAAVTNLSNVLK 116 +DI++TQ TN++ + + + +AA + +++ LK Sbjct: 164 KDIQQTQPTNIQNLFSVLKSVMDGLAACSRMADKLK 199 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 26.6 bits (56), Expect = 5.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 5 HEGHSRDAGHKHEDNHLFVYYRHRGNGS 88 H + +AG+KH+D Y+H GS Sbjct: 530 HNDTASEAGYKHDDTASEAGYKHNDTGS 557 >SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) Length = 144 Score = 26.2 bits (55), Expect = 7.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 173 WIIFHYFGKHSGCEVIVSIFEHIREICDGCHCRDG 69 W HY G E+I +IF+ +R+ + C C G Sbjct: 57 WAKGHY---SEGAELIDNIFDVLRKEAENCDCMQG 88 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 550 HQNLSINEMDSSSPKRPRQHQF 571 >SB_28992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 26.2 bits (55), Expect = 7.0 Identities = 10/48 (20%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -2 Query: 224 LSERRQHRKCREDNAFPWIIFHYFGKHSGC----EVIVSIFEHIREIC 93 ++ RQ + CR+ + PW H+ + + +++V++ + I+++C Sbjct: 367 IARERQAKLCRQRSWMPWKNGHWISRTAYSPKRHDLLVNVIKDIKDVC 414 >SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) Length = 672 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 56 HQNLSINEMDSSSPKRPRQHQF 77 >SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 21 HQNLSINEMDSSSPKRPRQHQF 42 >SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 50 HQNLSINEMDSSSPKRPRQHQF 71 >SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 21 HQNLSINEMDSSSPKRPRQHQF 42 >SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 26.2 bits (55), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 243 HQKLKLTEREEAAPKMPRGQRF 178 HQ L + E + ++PK PR +F Sbjct: 7 HQNLSINEMDSSSPKCPRQHQF 28 >SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 55 VCLLSPSRQWQPSQISLMCSKMETITS 135 +CLLS ++ QP I CS++ T +S Sbjct: 1383 ICLLSLQQEQQPLNIRSWCSQIPTSSS 1409 >SB_40852| Best HMM Match : SURF6 (HMM E-Value=3.8) Length = 296 Score = 25.8 bits (54), Expect = 9.2 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +3 Query: 126 DNFTARMFTEVVKNNPXKSVVLSAFSVLPPLAQLALA----SDGETHEELLKAIGFPDDD 293 D AR V NNP K++ LPP+ QL+ A S ++ E ++ FP + Sbjct: 106 DEVFARNRRHSVGNNPRKAMSYRELKRLPPIKQLSEAIQWPSGIKSGTEKVQFPQFPSAE 165 Query: 294 AIRT 305 ++T Sbjct: 166 VLKT 169 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,118,714 Number of Sequences: 59808 Number of extensions: 185731 Number of successful extensions: 704 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 498218920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -