BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0002 (674 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035763-1|AAH35763.2| 725|Homo sapiens exocyst complex compone... 77 8e-14 AL117352-4|CAI23095.1| 721|Homo sapiens exocyst complex compone... 77 8e-14 BC028352-1|AAH28352.1| 691|Homo sapiens TBC1 domain family, mem... 30 6.5 AK022147-1|BAB13971.1| 674|Homo sapiens protein ( Homo sapiens ... 30 6.5 >BC035763-1|AAH35763.2| 725|Homo sapiens exocyst complex component 8 protein. Length = 725 Score = 76.6 bits (180), Expect = 8e-14 Identities = 36/63 (57%), Positives = 47/63 (74%) Frame = +2 Query: 185 FVPERYVKDLARSCVGGEELQQQKEKIQNLAEETASALKKNVYENYMQFIETATEISHLE 364 F YVK L++ G +LQ+ +++IQ LAEETA LK+NVY+NY QFIETA EIS+LE Sbjct: 22 FEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLE 81 Query: 365 TEM 373 +EM Sbjct: 82 SEM 84 >AL117352-4|CAI23095.1| 721|Homo sapiens exocyst complex component 8 protein. Length = 721 Score = 76.6 bits (180), Expect = 8e-14 Identities = 36/63 (57%), Positives = 47/63 (74%) Frame = +2 Query: 185 FVPERYVKDLARSCVGGEELQQQKEKIQNLAEETASALKKNVYENYMQFIETATEISHLE 364 F YVK L++ G +LQ+ +++IQ LAEETA LK+NVY+NY QFIETA EIS+LE Sbjct: 18 FEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLE 77 Query: 365 TEM 373 +EM Sbjct: 78 SEM 80 >BC028352-1|AAH28352.1| 691|Homo sapiens TBC1 domain family, member 15 protein. Length = 691 Score = 30.3 bits (65), Expect = 6.5 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 488 RRDYQETRVINRSRXPRIEAWESTVSTERCSLNKCDSLTFLFRGGIS 348 R D E V+ R +E W + +E LN + +FRGG+S Sbjct: 302 RIDLGERPVVQRREPVSLEEWTKNIDSEGRILNVDNMKQMIFRGGLS 348 >AK022147-1|BAB13971.1| 674|Homo sapiens protein ( Homo sapiens cDNA FLJ12085 fis, clone HEMBB1002510, weakly similar to GYP7 PROTEIN. ). Length = 674 Score = 30.3 bits (65), Expect = 6.5 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 488 RRDYQETRVINRSRXPRIEAWESTVSTERCSLNKCDSLTFLFRGGIS 348 R D E V+ R +E W + +E LN + +FRGG+S Sbjct: 285 RIDLGERPVVQRREPVSLEEWTKNIDSEGRILNVDNMKQMIFRGGLS 331 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,688,781 Number of Sequences: 237096 Number of extensions: 1464557 Number of successful extensions: 3703 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3703 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -