BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0002 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 23 2.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.1 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 284 TASALKKNVYENYMQFIETATEISHLET 367 T+ L+ N NY+ ET+ ISH E+ Sbjct: 30 TSQQLEVNFDGNYINNFETSNGISHQES 57 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +1 Query: 238 GATATEGENTKFSRRNRKCPKEKCLRELYAVYRDCDGDIPPRNR 369 G +GE + + R+ P+ K L ++ +DC D+ N+ Sbjct: 1276 GKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNK 1319 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,072 Number of Sequences: 438 Number of extensions: 3123 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -