BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0001 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) 179 2e-45 SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 134 5e-32 SB_12613| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) 90 2e-18 SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 81 7e-16 SB_17270| Best HMM Match : ABC_tran (HMM E-Value=5.1e-08) 77 2e-14 SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) 74 1e-13 SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) 69 5e-12 SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) 61 1e-09 SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 57 1e-08 SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59776| Best HMM Match : ABC_tran (HMM E-Value=0.00016) 56 2e-08 SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) 56 3e-08 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 56 4e-08 SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) 53 3e-07 SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) 48 6e-06 SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) 47 2e-05 SB_39746| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_57977| Best HMM Match : ABC_tran (HMM E-Value=0.041) 44 1e-04 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 44 1e-04 SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) 41 0.001 SB_37816| Best HMM Match : ABC_tran (HMM E-Value=0.03) 40 0.002 SB_8906| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) 40 0.002 SB_25545| Best HMM Match : ABC_tran (HMM E-Value=0.00042) 40 0.002 SB_40065| Best HMM Match : ABC_tran (HMM E-Value=0.0055) 40 0.003 SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_16851| Best HMM Match : ABC_tran (HMM E-Value=6.1e-05) 39 0.004 SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) 38 0.007 SB_34083| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) 38 0.007 SB_3746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) 38 0.009 SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) 38 0.011 SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) 36 0.035 SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) 36 0.035 SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) 35 0.061 SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) 35 0.061 SB_39005| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.081 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_42079| Best HMM Match : L_lactis_RepB_C (HMM E-Value=0.16) 35 0.081 SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.081 SB_20992| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 34 0.11 SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) 34 0.14 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40697| Best HMM Match : ABC_tran (HMM E-Value=7.1e-07) 33 0.33 SB_31867| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 33 0.33 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 33 0.33 SB_28011| Best HMM Match : PSCyt1 (HMM E-Value=5.6) 32 0.43 SB_34997| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 32 0.57 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 32 0.57 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 32 0.57 SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_44600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) 31 0.75 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 31 0.99 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) 31 0.99 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) 31 1.3 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 31 1.3 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 30 1.7 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) 30 1.7 SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 30 1.7 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_20224| Best HMM Match : ABC_tran (HMM E-Value=2.2e-36) 30 2.3 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_52373| Best HMM Match : ABC_tran (HMM E-Value=3.4e-11) 30 2.3 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 3.0 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 29 4.0 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_48764| Best HMM Match : RhoGAP (HMM E-Value=0) 29 4.0 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 29 4.0 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) 29 5.3 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_44626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_32173| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-34) 29 5.3 SB_23783| Best HMM Match : ABC_tran (HMM E-Value=6.7e-07) 29 5.3 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 28 7.0 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 28 7.0 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 9.2 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) 28 9.2 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) 28 9.2 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 28 9.2 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 9.2 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 815 Score = 179 bits (436), Expect = 2e-45 Identities = 85/172 (49%), Positives = 122/172 (70%) Frame = +2 Query: 230 KIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRK 409 K I++ ++G F+SG+L +LGPSGAGKS+L+N+LAGYR + G I NG+ R+LRQFRK Sbjct: 139 KDIIKDVSGKFKSGELVGVLGPSGAGKSTLINVLAGYRTKFADGSIKVNGVERNLRQFRK 198 Query: 410 MSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATE 589 MS YIMQ+D+L P +TV+E+M ++A+L L I+ L L + +T Sbjct: 199 MSCYIMQDDVLLPHLTVMESMMVSANLHLKENMPLDDKERLIKEILINLGLLETADTRLS 258 Query: 590 RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 +SGG+RKR++I LEL+NNPP+IFLDEPT+GLD ++ C+SL++ +A GGR Sbjct: 259 EVSGGQRKRVAIALELINNPPLIFLDEPTSGLDSSSAYQCISLMRTLAHGGR 310 >SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 781 Score = 134 bits (325), Expect = 5e-32 Identities = 77/203 (37%), Positives = 126/203 (62%), Gaps = 7/203 (3%) Frame = +2 Query: 158 LPQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 +P+ V+ITF+DL + +G + K +L + G +SG++TA++GPSGAGK++ LN L+G Sbjct: 187 VPKNYTVDITFKDLNLKLNSG-TKKTVLMGVTGKIKSGEVTAVMGPSGAGKTTFLNTLSG 245 Query: 338 YRVNGSTG-LISTNGLPRD-LRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXX 511 G+ G I NG D L +R ++ ++ QED++ +TV E + A+L+L S Sbjct: 246 KAYYGTRGGEIFINGKKEDDLDMYRTITGFVPQEDVMHRNLTVKEVLRYQAELRLSSIVK 305 Query: 512 XXXXXXXXXXIIQLLRLGKARNTA----TER-LSGGERKRLSIGLELLNNPPVIFLDEPT 676 II+LL L + +++ T R +SGG+RKR++IG+EL+ +P ++FLDEPT Sbjct: 306 KAMKEERIHQIIELLELERIQDSQIGDETNRGISGGQRKRVNIGMELVVDPTLLFLDEPT 365 Query: 677 TGLDDVASSTCVSLLKRVARGGR 745 +GLD +S + ++ L+ VA GR Sbjct: 366 SGLDSTSSLSVLNALRAVAERGR 388 >SB_12613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 651 Score = 96.3 bits (229), Expect = 2e-20 Identities = 63/180 (35%), Positives = 93/180 (51%), Gaps = 8/180 (4%) Frame = +2 Query: 230 KIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGS--TGLISTNGLPRDLRQF 403 K IL +NG + G L AI+G SGAGKS+L+N+LA + +G + N L Sbjct: 207 KHILNDVNGTVKPGSLLAIMGASGAGKSTLMNVLAHRNIADMQVSGTVMVNERKVGL-DI 265 Query: 404 RKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTA 583 +S Y+ QEDL +TV E + A L+L II + L + +T Sbjct: 266 NTISAYVQQEDLFIGKLTVREHLVFQALLRLDKDLSLQERLYRVDQIIGEVGLRRCADTM 325 Query: 584 T------ERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 +SGGE+KRLS E+L +P ++F DEPT+GLD + T ++ L+++A GR Sbjct: 326 IGIPGRMRGISGGEKKRLSFASEVLTDPAILFADEPTSGLDAFMAQTVITTLQKMAAQGR 385 >SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 884 Score = 90.2 bits (214), Expect = 2e-18 Identities = 51/153 (33%), Positives = 87/153 (56%), Gaps = 3/153 (1%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGY-RVNGSTGLISTNGLPR--DLRQFRK 409 + ++ D GQ+TA+LG +GAGKS+L+ L G + + T LI + R DL + R+ Sbjct: 512 MHGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRR 571 Query: 410 MSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATE 589 Q+D++ F+TV E + LK G I++ + L + ++ + Sbjct: 572 NIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADA---ILKEIGLQEKKDDIAK 628 Query: 590 RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG++++LS+G+ L+ +P V+FLDEPT+G+D Sbjct: 629 NLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMD 661 >SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 433 Score = 81.8 bits (193), Expect = 5e-16 Identities = 43/117 (36%), Positives = 74/117 (63%), Gaps = 2/117 (1%) Frame = +2 Query: 158 LPQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 +P+ V+ITF+DL + +G + K +L + G +SG++TA++GPSGAGK++ LN L+G Sbjct: 305 VPKNYTVDITFKDLNLKLNSG-TKKTVLMGVTGKIKSGEVTAVMGPSGAGKTTFLNTLSG 363 Query: 338 YRVNGST-GLISTNGLPR-DLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGS 502 G+ G I NG+ D ++R ++ ++ QED++ +TV E + A+L+L S Sbjct: 364 KAYYGNRGGDIFINGVKESDFDKYRTITGFVPQEDVMHRNLTVKEVLRYQAELRLSS 420 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 81.4 bits (192), Expect = 7e-16 Identities = 52/189 (27%), Positives = 93/189 (49%), Gaps = 1/189 (0%) Frame = +2 Query: 176 VNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG-YRVNG 352 + + +DL + SK+ + +L+ + GQ+TA+LG +GAGK++ ++IL G + Sbjct: 196 IGVQIKDLRKVFKGSTGSKVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTS 255 Query: 353 STGLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXX 532 + +I + D+ R+ Q ++L +TV E + +LK G Sbjct: 256 GSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQ 315 Query: 533 XXXIIQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCV 712 +QLL KA+++ LSGG +++L+ + L+ +FLDEPT+G+D A Sbjct: 316 MITDLQLLDKRKAKSS---ELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATW 372 Query: 713 SLLKRVARG 739 LL + G Sbjct: 373 DLLLKHKAG 381 >SB_17270| Best HMM Match : ABC_tran (HMM E-Value=5.1e-08) Length = 771 Score = 77.0 bits (181), Expect = 2e-14 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 5/119 (4%) Frame = +2 Query: 404 RKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTA 583 R SR +ED++ +TV E + A+L+L S II+LL+L + +++ Sbjct: 244 RFSSRQWPEEDVMHRNLTVKEVLRYQAELRLSSSTKSSKKHERVQQIIELLQLERIQDSQ 303 Query: 584 -----TERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 +SGG+RKR++IG+EL+ +P ++FLDEPT+GLD +S + ++ L+ VA GR Sbjct: 304 IGDEENRGISGGQRKRVNIGMELVVDPTLLFLDEPTSGLDSTSSLSVLNALRAVAEKGR 362 >SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) Length = 127 Score = 74.1 bits (174), Expect = 1e-13 Identities = 41/121 (33%), Positives = 70/121 (57%), Gaps = 2/121 (1%) Frame = +2 Query: 224 SSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGST-GLISTNGLPR-DLR 397 S K +L + G SG++TA++GPSGAGK++ LN L+G G+ G I NG+ D Sbjct: 2 SKKKVLAGVTGKINSGEVTAVMGPSGAGKTTFLNTLSGKAYYGNRGGDIFINGVKESDFD 61 Query: 398 QFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARN 577 ++R ++ ++ QED++ +TV E + A+L+L S II+LL+L + ++ Sbjct: 62 KYRTITGFVPQEDVMHRNLTVKEVLRYQAELRLSSSTKSSKKHERVQQIIELLQLERIQD 121 Query: 578 T 580 + Sbjct: 122 S 122 >SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 68.5 bits (160), Expect = 5e-12 Identities = 42/158 (26%), Positives = 76/158 (48%), Gaps = 4/158 (2%) Frame = +2 Query: 284 ILGPS---GAGKSSLLNILAG-YRVNGSTGLISTNGLPRDLRQFRKMSRYIMQEDLLQPF 451 +L PS GAGK++ +L G V G + + + D+ + Y Q D L Sbjct: 1388 VLWPSWCDGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDL 1447 Query: 452 ITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATERLSGGERKRLSIGL 631 +T + + + A L+ G +IQ + L + ++ + SGG +++LS + Sbjct: 1448 LTAKDHLRLYARLR---GVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAI 1504 Query: 632 ELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 L+ NP ++F+DEPTTG+D A +++ + + GR Sbjct: 1505 ALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGR 1542 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +2 Query: 560 LGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLL 721 L R+ + LSGG +++LS+ + + V+ LDEPT G+D A + LL Sbjct: 432 LTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLL 485 >SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 958 Score = 66.5 bits (155), Expect = 2e-11 Identities = 35/89 (39%), Positives = 59/89 (66%), Gaps = 2/89 (2%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRKMS 415 IL+++NG R G++ A++GPSG+GK++LLN+LAG R+ G + NG + ++ +K Sbjct: 24 ILKTINGKVRPGEMLALMGPSGSGKTTLLNVLAG-RMAKDAGDVLINGKHMN-KKLKKRI 81 Query: 416 RYIMQEDLLQPFITVLEAMSMAA--DLKL 496 Y+MQED+ +T+ E ++ A D+KL Sbjct: 82 GYVMQEDIFFSHLTLKETLTKTAVSDVKL 110 >SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) Length = 284 Score = 60.9 bits (141), Expect = 1e-09 Identities = 50/144 (34%), Positives = 69/144 (47%), Gaps = 9/144 (6%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGS---TGLISTNGLPRDLRQFR 406 +L ++G G L A++G SGAGKS+L+N+LA YR GS TG + N L Sbjct: 132 VLFDVSGRAEPGTLLAVMGASGAGKSTLMNVLA-YRNLGSIQVTGEVKVNNNNLGL-AIN 189 Query: 407 KMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTA- 583 +S YI QEDL +TV E ++ A L++ I L L K +T Sbjct: 190 SISAYIQQEDLFIGTLTVREHLTFHALLRMDKKHSKQERLDRVEEAINELGLLKCADTVI 249 Query: 584 -----TERLSGGERKRLSIGLELL 640 +S GE+KRLS E+L Sbjct: 250 GTPGRVRGISAGEKKRLSFASEVL 273 >SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/59 (45%), Positives = 47/59 (79%) Frame = +2 Query: 161 PQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 P+ V++ F+DL+ T++ ++ K +L+S+ G+ R+G++TAI+GPSGAGK++LLN L+G Sbjct: 130 PKLSTVDLLFRDLSLTLK--QTGKQVLQSVTGEIRAGEVTAIMGPSGAGKTTLLNTLSG 186 >SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) Length = 562 Score = 57.2 bits (132), Expect = 1e-08 Identities = 35/146 (23%), Positives = 73/146 (50%), Gaps = 2/146 (1%) Frame = +2 Query: 218 GRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG--LPRD 391 G+ K++++ + G++ +LGP+GAGK++ LN++ + S G +S G L + Sbjct: 302 GKKGKVVVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTA-GIPASRGSVSVAGYDLQTE 360 Query: 392 LRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKA 571 + + + Q+D L IT+ E +++ A ++ G + +++ + Sbjct: 361 THKVFQHMGFCPQQDALFDDITLEEHLTLYASVR---GVPWASIDNVVNHYMSAMKITEH 417 Query: 572 RNTATERLSGGERKRLSIGLELLNNP 649 N + LSGG +++LS G+ +L P Sbjct: 418 ANKRAKELSGGTKRKLSFGMAMLGEP 443 >SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 56.8 bits (131), Expect = 2e-08 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 5/159 (3%) Frame = +2 Query: 227 SKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPR-----D 391 S +L+ ++ D G++ ++GPSG+GKS+LL + + G I G D Sbjct: 33 SNEVLKGISLDVAPGEVVCLIGPSGSGKSTLLRCV-NLLEQPNEGTIHVGGFEATDPDVD 91 Query: 392 LRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKA 571 + + R+ + Q+ L P +TVLE +++ G ++ + + + Sbjct: 92 IDKMRRKVGMVFQQFNLFPHLTVLENLTIGPIRVRKMGKAAAEALARNY--LERVHIPEQ 149 Query: 572 RNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + +LSGG+++R++I L +P + DEPT+ LD Sbjct: 150 ADKYPSQLSGGQQQRVAIARALCMDPIAMLFDEPTSALD 188 >SB_59776| Best HMM Match : ABC_tran (HMM E-Value=0.00016) Length = 113 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 +SGGE+KRLS E+L P ++F DEPT+GLD + + V+ L+++A GR Sbjct: 44 ISGGEQKRLSFASEILTGPSILFADEPTSGLDSFMAQSVVATLQKLAAQGR 94 >SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 844 Score = 56.0 bits (129), Expect = 3e-08 Identities = 40/157 (25%), Positives = 77/157 (49%), Gaps = 6/157 (3%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYR--VNGSTGLISTNGLPRDLRQFRK 409 +LR L+ + GQ A++GPSG GKS+ +++L + +G + + N +L+ R Sbjct: 684 VLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDGEMAIDNANVRQLNLKWLRS 743 Query: 410 MSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTAT- 586 + QE +L + ++ + ++ + + S + L K +T Sbjct: 744 KIGIVSQEPVLFGY-SIAQNIAYGDNSREVSMAEIETAAKAANIHNFICGLPKGYDTEVG 802 Query: 587 ---ERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 +SGG+++R++I L+ NPP++ LDE T+ LD Sbjct: 803 DKGTLISGGQKQRIAIARALIRNPPILLLDEATSALD 839 Score = 55.6 bits (128), Expect = 4e-08 Identities = 46/178 (25%), Positives = 89/178 (50%), Gaps = 8/178 (4%) Frame = +2 Query: 179 NITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGST 358 +I F D+ + + K+ L+ L+ RSGQ A++G SG GKS+L+ ++ + + + Sbjct: 116 DIDFTDIHFQYPSRPDVKV-LKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRF-YDPAE 173 Query: 359 GLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXX 538 G + +G+ D+R +++ Q + +L A ++A +++ G Sbjct: 174 GTVCMDGI--DIRSLNL--KWLRQHIGVVSQEPILFATTVAENIRYGREGITQAEIEKAT 229 Query: 539 XIIQ----LLRLGKARNTAT-ER---LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + + L + NT ER +SGG+++R++I L+ NP ++ LDE T+ LD Sbjct: 230 KMANAHDFIRNLPQGYNTVVGERGAQMSGGQKQRIAIARALVKNPTLLILDEATSALD 287 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = +2 Query: 596 SGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 SGG +++LS + L+ +PPV+FLDEPTTG+D VA L RV GR Sbjct: 1453 SGGNKRKLSTAIALVGDPPVVFLDEPTTGMDPVARRLLWDALSRVRAEGR 1502 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +2 Query: 230 KIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG-YRVNGSTGLISTNGLPRDLRQFR 406 K+ + ++ + GQ+TA+LG +GAGK++L+++L G + +++ + D+ R Sbjct: 322 KVAVDGVSLNMYEGQITALLGHNGAGKTTLMSMLTGLFPPTSGNAVVNGCSITDDISGVR 381 Query: 407 KMSRYIMQEDLLQPFIT 457 Q D+L +T Sbjct: 382 SSLDLCPQHDVLFDHLT 398 Score = 35.9 bits (79), Expect = 0.035 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 1/93 (1%) Frame = +2 Query: 218 GRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG-YRVNGSTGLISTNGLPRDL 394 G +S + + L+ G+ +LG +GAGK++ +L G + T + + R++ Sbjct: 1264 GGASLLAVDHLSLGVPMGECFGLLGINGAGKTTTFRMLTGDETMTSGTATVDNYDIRRNM 1323 Query: 395 RQFRKMSRYIMQEDLLQPFITVLEAMSMAADLK 493 Q R+ Y Q D L +T E + M A L+ Sbjct: 1324 NQVRQRIGYCPQFDALIDQMTGREVLYMYARLR 1356 >SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) Length = 336 Score = 52.8 bits (121), Expect = 3e-07 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%) Frame = +2 Query: 230 KIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRK 409 K +L++++ GQ A++G SG GKS+++ +L + GS G IS +G +D+ + Sbjct: 155 KPVLKNISFTVFPGQTLALVGNSGGGKSTIIRLLYRFYDVGS-GCISIDG--QDISKVT- 210 Query: 410 MSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXII----QLLRLGKARN 577 S+ + Q + P TVL + +++ G ++L + N Sbjct: 211 -SKSLRQVIGVVPQDTVLFNNDIRFNVRYGRLEADDAAVEEAAQAADIHNRILTFPEGYN 269 Query: 578 TAT-ER---LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + ER LSGGE++R++I +L NPPV+ LDE T+ LD Sbjct: 270 SLVGERGLKLSGGEKQRVAIARTVLKNPPVVLLDEATSALD 310 >SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) Length = 152 Score = 48.4 bits (110), Expect = 6e-06 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 4/109 (3%) Frame = +2 Query: 176 VNITFQDLTYTVQAGRSSKIILR-SLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNG 352 V + ++D+ V S K+ +G G+L A++G SG+GK++L+N+LA +R G Sbjct: 17 VTLEWRDINVLVPV-ESGKVYRHLCFSGKVNPGELVAVMGASGSGKTTLINVLA-HRNIG 74 Query: 353 S---TGLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADL 490 S +G++ N L +S YI QEDL +TV E + L Sbjct: 75 SMHVSGVVKANNKTLGL-AINSISAYIQQEDLFIGTLTVREHLKFQLGL 122 >SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) Length = 945 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/66 (33%), Positives = 36/66 (54%) Frame = +2 Query: 542 IIQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLL 721 +++ + L RN A E LSGG +++LS+ + + + LDEPT G+D A LL Sbjct: 590 LVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLL 649 Query: 722 KRVARG 739 + +G Sbjct: 650 IKYKKG 655 Score = 35.1 bits (77), Expect = 0.061 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = +2 Query: 155 HLPQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILA 334 HLP + +T +L ++G + + LN + GQ+ + LG +GAGK++ ++IL Sbjct: 497 HLP----LGVTIDNLQKVYKSGTKA---VDGLNLNLYEGQIMSFLGHNGAGKTTTMSILT 549 Query: 335 G-YRVNGSTGLISTNGLPRDLRQFR 406 G + TG I + + D+ + R Sbjct: 550 GLFPPTAGTGYIYGHDIRFDMDKIR 574 >SB_39746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 46.4 bits (105), Expect = 2e-05 Identities = 47/176 (26%), Positives = 81/176 (46%), Gaps = 12/176 (6%) Frame = +2 Query: 197 LTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG-YRVNGSTGLIST 373 L++ + R +L +++ GQ+ A++GPSG GKS+ +N+L Y G LI Sbjct: 356 LSWQLYPTRPDIPVLDNVSFMVEPGQVVALVGPSGGGKSTCINLLEHLYEPTGGEVLIDA 415 Query: 374 NGLPRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQL 553 + +DL + Y+ + L VL A S+ ++ G + +L Sbjct: 416 VPV-KDLDHY-----YLHNKVSLVGQEPVLFARSIKKNIAYGV-EDLADNPETVEHVSRL 468 Query: 554 LRL-----GKARNTATE------RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 G + TE +LSGG+++R++I L+ NP ++ LDE T+ LD Sbjct: 469 ANAHSFVSGMPKGYDTETGEKGLQLSGGQKQRIAIARALIRNPKILLLDEATSALD 524 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/51 (37%), Positives = 32/51 (62%) Frame = +2 Query: 587 ERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARG 739 + LSGG+R+R++I +L NP ++ LDE T+ LD + L+R+ +G Sbjct: 1188 QMLSGGQRQRIAIARAILKNPKILLLDEATSALDSESEHLVQEALERLMKG 1238 >SB_57977| Best HMM Match : ABC_tran (HMM E-Value=0.041) Length = 120 Score = 44.0 bits (99), Expect = 1e-04 Identities = 37/120 (30%), Positives = 53/120 (44%), Gaps = 8/120 (6%) Frame = +2 Query: 299 GAGKSSLLNILAGYRVNGS--TGLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLEAM 472 GAGKS+L+N+LA + G + NG L +S Y+ QEDL +TV E + Sbjct: 2 GAGKSTLMNVLAHRNIANMKVCGTVKVNGRAVGL-DINTISAYVQQEDLFIGKLTVREHL 60 Query: 473 SMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNT------ATERLSGGERKRLSIGLE 634 A L++ I+ L L + +T +SGGE+KRLS E Sbjct: 61 IFNALLRMEKHFTKRQRLERVEQILDELGLRRCADTLIGVPGRIRGISGGEKKRLSFASE 120 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/68 (36%), Positives = 41/68 (60%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTG 361 IT + L Y+ +S +L+++ R+ + I+G +GAGKSSLL +L +R+N G Sbjct: 756 ITAESLYYSYH--QSLPHVLKNVKFSIRNNEKVGIVGRTGAGKSSLLAVL--FRLNNPEG 811 Query: 362 LISTNGLP 385 L+ +GLP Sbjct: 812 LVRIDGLP 819 Score = 27.9 bits (59), Expect = 9.2 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG++ R+++ + + ++ LD+P + +D Sbjct: 154 LSGGQKARINLARAVYYDADIVLLDDPLSAVD 185 >SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 2/89 (2%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGY--RVNGS 355 I F D+ ++ + R +L++L+ G+ A++GPSG GKS++++++ + + G+ Sbjct: 158 IVFDDVRFSYPS-REDTEVLKALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGN 216 Query: 356 TGLISTNGLPRDLRQFRKMSRYIMQEDLL 442 + T+ DL +RK + QE +L Sbjct: 217 IRIGDTDISLLDLAWYRKKIALVSQEPVL 245 >SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) Length = 1301 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/52 (38%), Positives = 33/52 (63%) Frame = +2 Query: 590 RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGGR 745 +LSGG+++R++I L+ NP ++ LDE T+ LD + + L + AR GR Sbjct: 772 QLSGGQKQRVAIARALVRNPRILILDEATSALDTESERVVQAALDK-AREGR 822 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 3/67 (4%) Frame = +2 Query: 179 NITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGY--RVNG 352 ++TF D+ + + K+ L L+ RSGQ A++G SG GKS+++ ++ + NG Sbjct: 651 DVTFNDIHFYYPSRNEVKV-LNGLSLTVRSGQTVALVGESGCGKSTVIKLIQRFYDPENG 709 Query: 353 S-TGLIS 370 S G++S Sbjct: 710 SRIGVVS 716 >SB_37816| Best HMM Match : ABC_tran (HMM E-Value=0.03) Length = 73 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/50 (40%), Positives = 27/50 (54%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLKRVARGG 742 LS GE +R+ I L++ P + LDEP GLD + L+ VAR G Sbjct: 4 LSTGEARRVLIARALVHRPRALLLDEPCAGLDPATRRQFLEALRDVARSG 53 >SB_8906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1116 Score = 40.3 bits (90), Expect = 0.002 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 7/168 (4%) Frame = +2 Query: 206 TVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLP 385 T + S IL +N D +L ++GP G+GKS+LL+ + G + G I TNG Sbjct: 327 TSRKTESGDCILGKINLDLSGNRLALVIGPVGSGKSTLLSAICG-ASSSYKGKIKTNGSI 385 Query: 386 RDLRQFRKMSRYIMQEDLL-------QPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXI 544 + Q + + ++E+++ + + V+EA + D K Sbjct: 386 AYVSQEPWIFQGTVRENIMFNSFYDAERYQKVVEACDLKDDFKAFPNG------------ 433 Query: 545 IQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 L +G+ R A +SGG+R R+S+ + + + LD+P + +D Sbjct: 434 -DLSEIGE-RGIA---MSGGQRARVSLARAVYLDADIYLLDDPLSAVD 476 >SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 40.3 bits (90), Expect = 0.002 Identities = 42/154 (27%), Positives = 69/154 (44%), Gaps = 3/154 (1%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRKMS 415 IL+ + D L ++GP G+GKS+LL+ + G +G G + G + Q + Sbjct: 797 ILQDIELDVSGSCLVVVVGPVGSGKSTLLSTICGLE-SGFIGFLERRGTIAHVPQVPWIF 855 Query: 416 RYIMQEDL---LQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTAT 586 + +QE++ Q T E + A DL + L +G+ R A Sbjct: 856 QGTIQENITFNAQYDATKYERVVDACDLTVDLMTFPNG---------DLSEIGE-RGIA- 904 Query: 587 ERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ L + + LD+P + LD Sbjct: 905 --LSGGQRARVSLARALYLDADIYVLDDPLSALD 936 >SB_25545| Best HMM Match : ABC_tran (HMM E-Value=0.00042) Length = 146 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +2 Query: 560 LGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLL 721 L R+ + LSGG +++LS+ + + V+ LDEPT G+D A + LL Sbjct: 87 LTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLL 140 >SB_40065| Best HMM Match : ABC_tran (HMM E-Value=0.0055) Length = 400 Score = 39.5 bits (88), Expect = 0.003 Identities = 39/123 (31%), Positives = 57/123 (46%), Gaps = 9/123 (7%) Frame = +2 Query: 296 SGAGKSSLLNILAGYRVNGS---TGLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLE 466 SGAGKS+L+N+LA +R GS +G++ N L +S YI QEDL + E Sbjct: 11 SGAGKSTLINVLA-HRNIGSMHVSGVVKANNKTLGL-AINSISAYIQQEDLFR------E 62 Query: 467 AMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTA------TERLSGGERKRLSIG 628 + A L++ ++ L L K +T +SGGE+KRLS Sbjct: 63 HLKFQALLRMDRHVPDKERMLKVEEVLTELGLLKCADTVIGTPGRVRGISGGEQKRLSFA 122 Query: 629 LEL 637 E+ Sbjct: 123 SEV 125 >SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 39.5 bits (88), Expect = 0.003 Identities = 47/174 (27%), Positives = 73/174 (41%), Gaps = 5/174 (2%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTG 361 +TF+D++ + G S L + + + Q I G +GAGKSSLL L G Sbjct: 833 VTFRDMSLVYREGTPSA--LDDITLEITAKQKVGIAGRTGAGKSSLLAALFRMPEPGGEV 890 Query: 362 LISTNGLPR-DLRQFRKMSRYIMQEDLL--QPFITVLEAMSMAADLKLGSGXXXXXXXXX 532 LI L D++ R+ I Q+ +L L+ D ++ S Sbjct: 891 LIDGIDLGTIDIQAARRAMAVITQDPVLFGGTLRRNLDPFGKFTDQEIWSAIESVQLLNT 950 Query: 533 XXXIIQLL--RLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + L +LG++ +T S GER+ L + LL V+ LDE T +D Sbjct: 951 VRALPDQLMYQLGESGST----FSVGERQLLCLARALLQRCKVLVLDEATANVD 1000 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 39.1 bits (87), Expect = 0.004 Identities = 51/189 (26%), Positives = 79/189 (41%), Gaps = 10/189 (5%) Frame = +2 Query: 152 SHLPQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNIL 331 S P++ V++ L Y A K + S+N R G I G +GAGKSSL++ L Sbjct: 1002 SEWPKKGAVDLVNVSLAYYPGAPEVLKDVTFSINPAERVG----IAGRTGAGKSSLVSAL 1057 Query: 332 AGYRVNGSTGLISTNGL---PRDLRQFRKMSRYIMQEDLL--QPFITVLEAMSMAADLKL 496 +R+ G I +GL D++ R+ I Q+ +L L+ AD ++ Sbjct: 1058 --FRMPDPEGRILIDGLDISSIDIQSSRRAISVISQDPILFTGSLRLNLDPFDKYADEEI 1115 Query: 497 -----GSGXXXXXXXXXXXXIIQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIF 661 G+ + QL+ G LS GER+ L + +L +I Sbjct: 1116 WDALEGASLKRTILQMPGQLMTQLMECG-------SNLSAGERQLLCLARAMLQRNNIIV 1168 Query: 662 LDEPTTGLD 688 LDE T +D Sbjct: 1169 LDEATANVD 1177 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 257 DFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 + R+ L + GP G GK+SLL+ + G ++ G +S NG Sbjct: 437 ELRNSDLVLVTGPVGCGKTSLLSAILG-ELSVRKGDLSVNG 476 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+ + L + + LD+P + +D Sbjct: 538 LSGGQRTRIGLARALYADADIYLLDDPLSSVD 569 >SB_16851| Best HMM Match : ABC_tran (HMM E-Value=6.1e-05) Length = 113 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +2 Query: 563 GKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 G + T T+ SGG R R+S+ L P ++ LDEPT LD Sbjct: 59 GAMQQTQTKDFSGGWRMRISLARALFVRPTILLLDEPTNHLD 100 >SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) Length = 972 Score = 38.3 bits (85), Expect = 0.007 Identities = 36/156 (23%), Positives = 70/156 (44%), Gaps = 5/156 (3%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLP---RDLRQFR 406 +LR++N + G+ I+G +G KSSLL L R+N G++ +GLP L+ R Sbjct: 819 VLRNMNFCIKGGEKVGIVGRNGLEKSSLLAAL--LRLNTPEGIVRIDGLPITDLQLQDLR 876 Query: 407 KMSRYIMQEDLLQP--FITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNT 580 + I Q+ +L ++ + +D L +G + + A Sbjct: 877 RRISVIPQDPVLFSGCLRKNVDPFAQFSDDALWNGLEEVHLRETVDKLPDGIETELAEKG 936 Query: 581 ATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + S G+R+ + + +L++ ++ +DE T +D Sbjct: 937 S--NFSVGQRQLVCLARAILSHNKILVIDEATANVD 970 >SB_34083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 38.3 bits (85), Expect = 0.007 Identities = 40/158 (25%), Positives = 63/158 (39%), Gaps = 2/158 (1%) Frame = +2 Query: 221 RSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQ 400 +S+ +L LN R GQL ++G G+GKSSLL+ L ++ TG + GL Sbjct: 74 KSTVGLLSGLNLSIRKGQLIGVIGGVGSGKSSLLSALTA-EMDKLTGQVFVAGLDGGF-- 130 Query: 401 FRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNT 580 + QE +Q TV E + + +Q L G Sbjct: 131 -----GLVAQEPWIQ-HATVKENILFGKPYDVDK-YSDVINACALREDLQSLPAGDDTEI 183 Query: 581 ATE--RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG++ R+ + + N + LD+P +D Sbjct: 184 GENGVNLSGGQKARVGLARAVYQNKSIYLLDDPLAAVD 221 >SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) Length = 240 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLP 385 ILR L+ D + G++T +LG +G GK++LL L G + G + G P Sbjct: 98 ILRGLSFDVKVGEVTCLLGRNGVGKTTLLKCLMGL-IPAKEGAVQWEGQP 146 >SB_3746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 +L +N DF +L + GP G+GKSSLL L G + S G + T G Sbjct: 89 VLSDINMDFNENKLVLVTGPVGSGKSSLLLTLLG-ELLPSEGSVKTRG 135 >SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) Length = 1515 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +2 Query: 224 SSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPR---DL 394 +S +LR + D R G+ I+G +GAGKSS+ L +R+ TG + +G+ ++ Sbjct: 1347 NSPCVLRDITLDVRPGERVGIVGKTGAGKSSVFAAL--FRMPDPTGEVWVDGVELASVEI 1404 Query: 395 RQFRKMSRYIMQEDLL 442 R RK I Q +L Sbjct: 1405 RTVRKALAVITQNPVL 1420 Score = 31.5 bits (68), Expect = 0.75 Identities = 40/145 (27%), Positives = 65/145 (44%), Gaps = 7/145 (4%) Frame = +2 Query: 275 LTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRKMSRYIMQEDLL---- 442 L I GP G GKSSLL + G + +G IS G + Q +S ++E++ Sbjct: 597 LVIITGPVGGGKSSLLLSILG-EIPLISGSISVRGRIAYVPQIPWISSGTIRENITFGKQ 655 Query: 443 ---QPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATERLSGGERK 613 + + VLE S+ +DL L L +G+ R + LSGG++ Sbjct: 656 MEEERYNKVLEVCSLVSDLSLFPRG-------------DLTVIGE-RGAS---LSGGQQS 698 Query: 614 RLSIGLELLNNPPVIFLDEPTTGLD 688 R+S+ + + + LD+P + LD Sbjct: 699 RVSLARAVYADVEIYLLDDPFSSLD 723 >SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) Length = 665 Score = 37.5 bits (83), Expect = 0.011 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 7/168 (4%) Frame = +2 Query: 206 TVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLP 385 T + S IL +N D +L ++GP G+GKS+LL+ + + G I TNG Sbjct: 195 TSRKTESGDCILGKINLDLSGNRLALVIGPVGSGKSTLLSAIC-CASSSYKGKIKTNGSI 253 Query: 386 RDLRQFRKMSRYIMQEDLL-------QPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXI 544 + Q + + ++E+++ + + V+EA + D K Sbjct: 254 AYVSQEPWIFQGTVRENIIFNSTYDAERYQKVVEACDLKEDFKAFPNG------------ 301 Query: 545 IQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 L +G+ R A +SGG+R R+S+ + + + LD+P + +D Sbjct: 302 -DLSEIGE-RGIA---MSGGQRARVSLARAVYLDADIYLLDDPLSAVD 344 >SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1308 Score = 35.9 bits (79), Expect = 0.035 Identities = 38/176 (21%), Positives = 81/176 (46%), Gaps = 7/176 (3%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTG 361 I +DLT + Q + + + +N + A++G G+GK++LL+ + G +V+ + G Sbjct: 408 IEVKDLTISFQKHKGGRDVFCDVNLSVEENDIVAVIGAVGSGKTTLLSAILG-QVSCTKG 466 Query: 362 LISTNGLPRDLRQFRKMSRYIMQEDLL-------QPFITVLEAMSMAADLKLGSGXXXXX 520 I + G + Q + ++E++ + + +++A ++ D +L S Sbjct: 467 KIKSRGTICHVPQVPWIFNGSVRENITFGLPYDEEKYGRIIDACALRKDFELFSNG---- 522 Query: 521 XXXXXXXIIQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 L +G+ R A LSGG+R R+S+ + + + +D+ + LD Sbjct: 523 ---------DLTVIGE-RGVA---LSGGQRARVSLARAVYADAEIYLIDDTLSALD 565 >SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1184 Score = 35.9 bits (79), Expect = 0.035 Identities = 40/168 (23%), Positives = 73/168 (43%), Gaps = 5/168 (2%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGL---PRDLRQFR 406 IL+ + F + T I+G +G+GKSSL + A R+ + G I +G+ ++R+ R Sbjct: 987 ILKGVTCKFEGRKNTGIMGRTGSGKSSL--VAALMRMPEADGKIFVDGIDISTVNIRETR 1044 Query: 407 KMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLL--RLGKARNT 580 K + Q ++ ++ E + + S +++ L RL Sbjct: 1045 KRMSILSQSPVIFRG-SIRENLDPYGEF-ADSEIWGTLERVQMRDVVENLESRLHYKLMD 1102 Query: 581 ATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVSLLK 724 LS GER+ + + LL ++ LDEPT +D + + L+ Sbjct: 1103 EGSNLSLGERQLICLARVLLRKNRILILDEPTAHVDPLTTEKIQQALR 1150 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 224 SSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 ++ +++ + G LTA+ GP G+GK+SLL ++G Sbjct: 424 NNNVLINDITVQLPEGSLTAVTGPVGSGKTSLLLTISG 461 >SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) Length = 569 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 L ++ + G+L AI+GP GAGKSSLL + G + + G I+ G Sbjct: 145 LALIDNSYFKGELLAIVGPVGAGKSSLLMAILG-ELPFTEGTITVKG 190 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLDDVASSTCVS 715 LSGG++ R+++ + ++ + LD+P + +D A C++ Sbjct: 252 LSGGQKARVTLARAVYSDADIYLLDDPLSAVD--AHGKCIA 290 >SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) Length = 322 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 IT +D+ G +++ SL + + G I GP+G GKSSL IL+G Sbjct: 67 ITLRDVAVITPCG---DVVVSSLAFEMQPGMHLLITGPNGCGKSSLFRILSG 115 >SB_39005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 34.7 bits (76), Expect = 0.081 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 L ++ D G A+LGP+GAGKS+ + IL+ V S+G ++ G Sbjct: 125 LHGIDLDVAEGDFYALLGPNGAGKSTTIGILSTL-VTKSSGTVNVFG 170 >SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 618 Score = 34.7 bits (76), Expect = 0.081 Identities = 38/174 (21%), Positives = 76/174 (43%), Gaps = 5/174 (2%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTG 361 ITF +++++ +S +L ++ + + ++G +GAGKSSLL+ L +R+ G Sbjct: 35 ITFDNMSFSYH--QSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTL--FRLAEPKG 90 Query: 362 LISTNGL---PRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXX 532 LI +G+ L+ R I Q+ +L F + +G Sbjct: 91 LIDIDGINIRKLGLKDLRSKLSIIPQDPVL--FSGTMRKNLDPFSEHPDAGLWKVLDEVQ 148 Query: 533 XXXIIQLL--RLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 ++ L +L + A S G+R+ + + +L + ++ +DE T +D Sbjct: 149 LKQPVEDLPGKLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVD 202 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 34.7 bits (76), Expect = 0.081 Identities = 41/175 (23%), Positives = 75/175 (42%), Gaps = 5/175 (2%) Frame = +2 Query: 179 NITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGST 358 N+ F++++ G +L +LN D + G+ + G +GAGKSSL + A +R+ Sbjct: 231 NVKFENVSLRYYEGGPQ--VLHNLNIDIKGGERVGVAGRTGAGKSSL--VAALFRMPDPE 286 Query: 359 G--LISTNGLPR-DLRQFRKMSRYIMQE-DLLQPFITV-LEAMSMAADLKLGSGXXXXXX 523 G +I + + +++ R++ I Q L + + L+ S D L + Sbjct: 287 GKIIIDDQEIGQLNIQNTRRVISVITQNPTLFSGSLRINLDPFSRYDDAALWNVLEQVEM 346 Query: 524 XXXXXXIIQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + L + + GER+ L + LLN +I +DE T +D Sbjct: 347 KDKVKELPGELYF--ELSESGNNFGVGERQLLCLARALLNKNKIIVMDEATANVD 399 >SB_42079| Best HMM Match : L_lactis_RepB_C (HMM E-Value=0.16) Length = 641 Score = 34.7 bits (76), Expect = 0.081 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 545 IQLLRLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDE 670 I+ + L + T + SGG +++LS + L+ +PP+IFL + Sbjct: 5 IRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFLKQ 46 >SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1238 Score = 34.7 bits (76), Expect = 0.081 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 7/176 (3%) Frame = +2 Query: 182 ITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTG 361 ++ QD++ G + +L ++ + + + I+G +GAGKSSL + A +R+ G Sbjct: 995 LSVQDMSLVYHEGGAR--VLEGISLEVQPKEKVGIVGRTGAGKSSL--VAALFRMPEPKG 1050 Query: 362 LISTNGL---PRDLRQFRKMSRYIMQEDLL--QPFITVLEAMSMAADLKLGSGXXXXXXX 526 + +G+ D++ RK I QE +L L+ M + ++ + Sbjct: 1051 RVLIDGVDLGTLDIQSARKAMAVITQEPVLFSGTLKRNLDPMQQFTNQEVWTALENVQMM 1110 Query: 527 XXXXXIIQLL--RLGKARNTATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 + L RLG++ + S GER+ L + LL ++ LDE T +D Sbjct: 1111 KCVKRLPGKLEYRLGESGS----GFSVGERQLLCLARALLQKSKLLVLDEATANVD 1162 >SB_20992| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 641 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = +2 Query: 155 HLPQRPLVNITFQDLTYTVQAGRSS---KIILRSLNG---DFRSGQLTAILGPSGAGKSS 316 HL + L + T +L V A +I + +L+G D SG L ++G G+GKSS Sbjct: 3 HLSRTALASTTTGNLINLVSADAQKFDWEIAIPTLDGLSFDVPSGCLLGVIGAVGSGKSS 62 Query: 317 LLNILAG 337 LLN + G Sbjct: 63 LLNAILG 69 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ + + + LD+P + +D Sbjct: 144 LSGGQRARISLARAVYADGDIYLLDDPLSAVD 175 >SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) Length = 235 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 233 IILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 ++ S+N D +G L A++G G GKS+LL+ L G Sbjct: 189 LVALSINLDVPAGSLVAVVGQVGCGKSTLLSALLG 223 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -3 Query: 138 PSARDALRDSILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 PS++ L L L+ S I+L+ NSCSPGDPL Sbjct: 6 PSSKLTLTKGNKMLVRGPPLLRSTVSISLISNSCSPGDPL 45 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +2 Query: 218 GRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 G S LRSL+ G+L + GP G GKS+LL+++ G + S+G + G Sbjct: 496 GDVSPPALRSLSCMAFPGELVLVTGPVGCGKSTLLSVILG-EIPISSGKVLRGG 548 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLI 367 +L+ ++ + GQ ++G +GAGKSSL+ + YR+ G I Sbjct: 1187 VLKRISVHIKDGQKVGVVGRTGAGKSSLVRAI--YRMPEPQGAI 1228 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -3 Query: 117 RDSILSLPTRSQLI-MSC-TCITLVPNSCSPGDPL 19 +D + S+P Q++ SC +C+ NSCSPGDPL Sbjct: 47 QDLVESVPHSLQMLAFSCVSCVVQKSNSCSPGDPL 81 >SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/51 (31%), Positives = 33/51 (64%) Frame = +2 Query: 179 NITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNIL 331 +I +DL++ ++ +L+ LN + ++TAI+G SG+GK++L+ +L Sbjct: 223 DIIIKDLSFRYLGSDTN--VLKELNMTIPAKKITAIVGTSGSGKTTLMKLL 271 >SB_40697| Best HMM Match : ABC_tran (HMM E-Value=7.1e-07) Length = 659 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 212 QAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 Q S IL ++ + L A++GP G+GKS+LL ++G Sbjct: 399 QENDKSVNILHDISMEVSDDSLVAVIGPVGSGKSTLLETISG 440 >SB_31867| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 674 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 L L+ D SG L ++G G+GKSSLLN + G Sbjct: 368 LDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILG 400 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ + + + LD+P + +D Sbjct: 475 LSGGQRARISLARAVYADGDIYLLDDPLSAVD 506 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 32.7 bits (71), Expect = 0.33 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 602 GERKRLSIGLELLNNPPVIFLDEPTTGLD 688 G++ R++ L+NP V+ LDEPT LD Sbjct: 448 GQKSRVAFADMALSNPDVVILDEPTNNLD 476 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 114 DSILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 +SILS + ++S T+ NSCSPGDPL Sbjct: 25 ESILSQRKAKKRVLSAVFETVPSNSCSPGDPL 56 >SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +2 Query: 548 QLLRLGKARNTATE---RLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 QL R G + AT LSGG++ R+ + P ++ LDEPT LD Sbjct: 439 QLGRYGVSGELATRPIISLSGGQKSRVVFASMTMGGPNLLVLDEPTNHLD 488 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 32.7 bits (71), Expect = 0.33 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 96 PTRSQLIMSCTCITLVPNSCSPGDPL 19 P L S C+ + NSCSPGDPL Sbjct: 75 PPSPILYCSAECVMTISNSCSPGDPL 100 >SB_28011| Best HMM Match : PSCyt1 (HMM E-Value=5.6) Length = 491 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILA 334 L S+ R G+LT GP+GAGK++LL+ L+ Sbjct: 390 LNSILKGHRRGELTIFTGPTGAGKTTLLSELS 421 >SB_34997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 31.9 bits (69), Expect = 0.57 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 206 TVQAGRSSK-IILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNG 379 T GR+++ L++LN + +LT I GP G+GKS+LL + G + + G I T G Sbjct: 480 TCHWGRTNQETALQNLNMRANAKELTLINGPGGSGKSTLLLAVLG-ELPVTEGSILTEG 537 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGL---PRDLRQFR 406 +L+ ++ + + I+G +GAGKSSLL L +R+ G I +G+ LR R Sbjct: 891 VLKDVSVHIKPAEKVGIVGRTGAGKSSLLATL--FRMAEPKGKIEIDGVDITKLGLRDLR 948 Query: 407 KMSRYIMQEDLL 442 I QE LL Sbjct: 949 TSIAIIPQEPLL 960 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 31.9 bits (69), Expect = 0.57 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 269 GQLTAILGPSGAGKSSLLNILAG 337 G A++GPSG+GKS+LL + G Sbjct: 35 GTFAAVMGPSGSGKSTLLGLAVG 57 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +1 Query: 466 GNVDGRRPEARVRGGERDKSRCGGRNNSAVETRQSQEHS 582 GN RRP RVRGG K G RN S + SQE++ Sbjct: 354 GNKSLRRP-VRVRGGSGGKGGRGSRNRSTSDQPSSQENT 391 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 31.9 bits (69), Expect = 0.57 Identities = 33/150 (22%), Positives = 67/150 (44%) Frame = +2 Query: 239 LRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRKMSR 418 L ++N + G L A++G G GKS+LL+ L G TG + G + Q + Sbjct: 564 LHNINLNIPDGSLVAVVGQVGCGKSTLLSALLG-ETEKVTGEVYVKGSVAYVPQQAWIQN 622 Query: 419 YIMQEDLLQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATERLS 598 ++++++ F ++ +K+ + + +G+ R LS Sbjct: 623 ATLRDNVI--FGRNFDSRRYHKTIKVCALETDFDILPAG----DMTEIGE-RGI---NLS 672 Query: 599 GGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 GG+++R+++ + N V LD+P + +D Sbjct: 673 GGQKQRVNLARAVYFNADVYLLDDPLSAVD 702 >SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 31.9 bits (69), Expect = 0.57 Identities = 48/182 (26%), Positives = 70/182 (38%), Gaps = 6/182 (3%) Frame = +2 Query: 161 PQRPLVNITFQDLTYTVQAGRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGY 340 P + I DL Y S + L+ ++ D + G+ I+G +GAGKSSL LA + Sbjct: 896 PNTGNIKIDSLDLRYR----ESLPLALKDISCDIQPGEKIGIVGRTGAGKSSL--SLALF 949 Query: 341 R-VNGSTGLISTNGL---PRDLRQFRKMSRYIMQEDLLQPFITVLEAMSMAADLKLGSGX 508 R + + G I +G+ L R I Q+ +L F L D Sbjct: 950 RMLEAAGGKIVIDGVDIAKIGLHDLRSRLTIIPQDPVL--FSGTLRFNLDPFDAYSDEDL 1007 Query: 509 XXXXXXXXXXXIIQLLRLGKARNTAT--ERLSGGERKRLSIGLELLNNPPVIFLDEPTTG 682 L G A E LS G+R+ + + LL V+ LDE T Sbjct: 1008 WEVLEVSHLKAFASGLPEGLLHPIAEGGENLSVGQRQLVCLARALLRKSKVLVLDEATAA 1067 Query: 683 LD 688 +D Sbjct: 1068 VD 1069 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 245 SLNGDFRSGQLTAILGPSGAGKSSLLNILAG 337 S+N + G L A++G G GKS+LL+ L G Sbjct: 295 SINLNIPEGSLVAVVGQVGCGKSTLLSALLG 325 >SB_44600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 31.5 bits (68), Expect = 0.75 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +2 Query: 299 GAGKSSLLNILAGYRVNGS--TGLISTNGLPRDLRQFRKMSRYIMQEDLLQPFITVLE 466 GAGKS+L+N+LA + +G + N L +S Y+ QEDL +TV E Sbjct: 2 GAGKSTLMNVLAHRNIADMQVSGTVMVNERKVGL-DINTISAYVQQEDLFIGKLTVRE 58 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 114 DSILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 D ++ + + L S T T+ NSCSPGDPL Sbjct: 26 DYVIEVCAAAGLTKSTTESTITSNSCSPGDPL 57 >SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1266 Score = 31.5 bits (68), Expect = 0.75 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 7/142 (4%) Frame = +2 Query: 284 ILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPR---DLRQFRKMSRYIMQEDLL--QP 448 I+G +GAGKSSL+ L +R+ G I +G+ +++ R+ I Q L+ Sbjct: 1057 IVGRTGAGKSSLVAAL--FRIREPKGRIVVDGIDLGSLNIQDARRAMSVITQTPLVFSGS 1114 Query: 449 FITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLL--RLGKARNTATERLSGGERKRLS 622 L+ +D ++ + + L RLG++ + S GER+ L Sbjct: 1115 LRKNLDPFRCFSDQEIWTALNNVQMKKCVESLPGKLEYRLGESGSG----FSVGERQLLC 1170 Query: 623 IGLELLNNPPVIFLDEPTTGLD 688 + LL N +I LDE T +D Sbjct: 1171 LARALLQNTKLIVLDEATANVD 1192 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R RLS+ + + + LD+P + +D Sbjct: 554 LSGGQRSRLSLARAVYSGADIFLLDDPLSAVD 585 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 78 IMSCTCITLVPNSCSPGDPL 19 +M C + + NSCSPGDPL Sbjct: 43 LMECDYVNDISNSCSPGDPL 62 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 69 CTCITLVPNSCSPGDPL 19 C C V NSCSPGDPL Sbjct: 19 CDCHAHVSNSCSPGDPL 35 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 63 CITLVPNSCSPGDPL 19 CI V NSCSPGDPL Sbjct: 30 CICTVSNSCSPGDPL 44 >SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) Length = 617 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 304 WEKLLTEYFSGIQG*RVDRPDLHQW 378 + KLL + ++G+ G VD PDLHQ+ Sbjct: 586 YSKLLCQVYAGVHGKDVDDPDLHQF 610 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) Length = 283 Score = 30.7 bits (66), Expect = 1.3 Identities = 41/157 (26%), Positives = 64/157 (40%), Gaps = 6/157 (3%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGL----ISTNGLPRDLRQF 403 +L+ + Q + G +GAGKSS++ L STG+ + GL +L+ Sbjct: 70 VLKGVTFSVEPQQKIGVAGRTGAGKSSIVASLMRMP-EASTGIHIDDVDIRGL--NLQST 126 Query: 404 RKMSRYIMQED-LLQPFI-TVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARN 577 R++ I Q LL I + L+ + M D ++ S L Sbjct: 127 RQVVSVIQQNPTLLSGTIRSNLDPLDMYTDDEIWSALSDVNLSPVMDK--WAYDLEHRIE 184 Query: 578 TATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LS GER+ S+ LL +I +DE TT +D Sbjct: 185 EGGVNLSVGERQLFSLARALLQKNKIIVMDEATTNVD 221 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ + ++ V+ LD+P + +D Sbjct: 683 LSGGQRSRVSLARAVYSDCDVLLLDDPLSAVD 714 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 78 IMSCTCITLVPNSCSPGDPL 19 ++S + L+ NSCSPGDPL Sbjct: 8 LISANIVFLISNSCSPGDPL 27 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 27 STVSISLISNSCSPGDPL 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S I+L+ NSCSPGDPL Sbjct: 25 STVSISLISNSCSPGDPL 42 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 75 MSCTCITLVPNSCSPGDPL 19 M+ T IT NSCSPGDPL Sbjct: 1 MAKTGITTTSNSCSPGDPL 19 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 21 VDPPGCRNSARGLCR 65 VDPPGCRNS LC+ Sbjct: 16 VDPPGCRNSISKLCK 30 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 81 LIMSCTCITLVPNSCSPGDPL 19 L+++ TL+ NSCSPGDPL Sbjct: 53 LVLAPVSRTLLSNSCSPGDPL 73 >SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) Length = 355 Score = 30.3 bits (65), Expect = 1.7 Identities = 36/156 (23%), Positives = 64/156 (41%), Gaps = 5/156 (3%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLP---RDLRQFR 406 +L+ + Q I G +GAGKSS++ L R+ +T I +G+ +L+ R Sbjct: 135 VLKDVTFSIEPQQKIGIAGRTGAGKSSIVASLM--RMPEATPGIQIDGVDICGLNLQSTR 192 Query: 407 KMSRYIMQEDLL--QPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNT 580 + I Q ++ L+ + D ++ S ++ L+ Sbjct: 193 QAVSVIQQNPVMFCGSIRNNLDPFDIYTDDEIWSALHDAKVGPLVSGLVGKLKYHIQEGG 252 Query: 581 ATERLSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 A S GER+ S+ LL+ +I +DE T +D Sbjct: 253 AN--FSVGERQLFSLARALLHKKKIIVMDEATANVD 286 >SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 30.3 bits (65), Expect = 1.7 Identities = 31/143 (21%), Positives = 53/143 (37%) Frame = +2 Query: 260 FRSGQLTAILGPSGAGKSSLLNILAGYRVNGSTGLISTNGLPRDLRQFRKMSRYIMQEDL 439 F GQ I G +G GK+SLL ++ G S ++ + F + L Sbjct: 1569 FARGQNVLITGMAGCGKTSLLRVIRGLWEPLSGDVVRNIDFEPEKVLFLSQHALLTNGSL 1628 Query: 440 LQPFITVLEAMSMAADLKLGSGXXXXXXXXXXXXIIQLLRLGKARNTATERLSGGERKRL 619 + + LEA ++ + + L + + LS GE +RL Sbjct: 1629 KEQVVFPLEAEDYLDHTRIMDLLSEVGLASVCRRVGGIDSL--VDGSWEDMLSHGEIQRL 1686 Query: 620 SIGLELLNNPPVIFLDEPTTGLD 688 + + P + +DE T+ LD Sbjct: 1687 AFARLFYHQPDLAMMDEATSALD 1709 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 97 TNSLSAYHVLYLHNPRAEFLQPGGST 20 T++ + Y V + + R EFLQPGGST Sbjct: 213 TDNKTHYSVRHTYENRIEFLQPGGST 238 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 218 GRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLL 322 G +K +L + + +L I GP G+GKSSLL Sbjct: 257 GSLAKSVLSDITLKLKGSRLIGITGPCGSGKSSLL 291 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 114 DSILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 D+++S R ++ + LV NSCSPGDPL Sbjct: 6 DTLISANIRISVLALKSRPMLVSNSCSPGDPL 37 >SB_20224| Best HMM Match : ABC_tran (HMM E-Value=2.2e-36) Length = 380 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 218 GRSSKIILRSLNGDFRSGQLTAILGPSGAGKSSLL 322 G S K L L+ G L A+ GP G+GKS+LL Sbjct: 157 GISPKSSLSRLSFRINQGGLLAVTGPIGSGKSTLL 191 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+ R+S+ + + VI LD+P + +D Sbjct: 271 LSGGQCSRISLARAVYSRASVILLDDPLSRVD 302 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 69 CTCITLVPNSCSPGDPL 19 C I L NSCSPGDPL Sbjct: 73 CKGILLTSNSCSPGDPL 89 >SB_52373| Best HMM Match : ABC_tran (HMM E-Value=3.4e-11) Length = 406 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ L + + LD+P + LD Sbjct: 197 LSGGQRARVSLARALYLDADIYVLDDPLSALD 228 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 96 PTRSQLIMSCTCITLVP-NSCSPGDPL 19 P L+ CT L P NSCSPGDPL Sbjct: 39 PCTPPLLSPCTPPHLSPSNSCSPGDPL 65 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 +T+V NSCSPGDPL Sbjct: 17 LTVVSNSCSPGDPL 30 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 108 ILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 + ++ R+ +M T + + NSCSPGDPL Sbjct: 7 VRAVDPRNAELMVVTEVIITSNSCSPGDPL 36 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 IT V NSCSPGDPL Sbjct: 7 ITAVSNSCSPGDPL 20 >SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = +2 Query: 281 AILGPSGAGKSSLLNILAG 337 A++GP+GAGKS+LL ++ G Sbjct: 90 ALVGPNGAGKSTLLKLIEG 108 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = -3 Query: 135 SARDALRDSILSLPTRSQLIMSCTCI---TLVP--NSCSPGDPL 19 S D L D L + + S T I T +P NSCSPGDPL Sbjct: 150 SEDDDLLDDFLQIDVTVSVTNSLTVIAGTTTIPPSNSCSPGDPL 193 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 T+V NSCSPGDPL Sbjct: 76 TIVSNSCSPGDPL 88 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 66 TCITLVPNSCSPGDPL 19 T I L+ NSCSPGDPL Sbjct: 50 TYIPLLSNSCSPGDPL 65 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 ++L+ NSCSPGDPL Sbjct: 31 VSLISNSCSPGDPL 44 >SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 263 RSGQLTAILGPSGAGKSSLLNILAG 337 R G++ ++G +G GKS+ L ILAG Sbjct: 109 RPGEVLGLVGTNGIGKSTALKILAG 133 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 254 GDFRSGQLTAILGPSGAGKSSLLNILAG 337 G+F ++ +LG +G GK++ + +LAG Sbjct: 340 GEFTDSEIIVMLGENGTGKTTFIRMLAG 367 >SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 73 VLYLHNPRAEFLQPGGST 20 V Y NP EFLQPGGST Sbjct: 9 VQYRDNPWIEFLQPGGST 26 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -3 Query: 114 DSILS--LPTRSQLIMSCTCITLVPNSCSPGDPL 19 D+++S +PTR ++ LV NSCSPGDPL Sbjct: 6 DTLISANIPTRYAILSPRA--RLVSNSCSPGDPL 37 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 99 LPTRSQLIMSCTCITLVPNSCSPGDPL 19 L + I +CT NSCSPGDPL Sbjct: 38 LEQKQNAIRACTDKPFRSNSCSPGDPL 64 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ + ++ + +D+P + +D Sbjct: 604 LSGGQRSRVSLARAVYSDADIFLMDDPLSAVD 635 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 61 HNPRAEFLQPGGSTV 17 H+ R EFLQPGGST+ Sbjct: 33 HHGRIEFLQPGGSTI 47 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 61 HNPRAEFLQPGGST 20 +NP EFLQPGGST Sbjct: 26 YNPEIEFLQPGGST 39 >SB_48764| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 583 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -3 Query: 438 KSSCMMYRDIFRNCRRSRGSPLVEIRPVDPLTLYPAKIFSKE-LFPAPEGPRMAVS*P 268 ++S RDI R RR+ + E RP+ PA ++ E APE P S P Sbjct: 444 RASTGTQRDIDRQTRRNSETKPTEQRPLSVYDNRPASVYDNEPTIKAPEAPLYRYSSP 501 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 TL+ NSCSPGDPL Sbjct: 1 TLLSNSCSPGDPL 13 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 +T+ NSCSPGDPL Sbjct: 2 VTIASNSCSPGDPL 15 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -3 Query: 111 SILSLPTRSQLIMSCTC---ITLVPNSCSPGDPL 19 SI+ LP + ++ S T I + NSCSPGDPL Sbjct: 31 SIVGLPVK--ILASKTAGDVIAFISNSCSPGDPL 62 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 T++ NSCSPGDPL Sbjct: 3 TIISNSCSPGDPL 15 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -3 Query: 66 TCITLVP-NSCSPGDPL 19 T + LVP NSCSPGDPL Sbjct: 23 TTLPLVPSNSCSPGDPL 39 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 66 TCITLVPNSCSPGDPL 19 +C + NSCSPGDPL Sbjct: 2 SCTYFISNSCSPGDPL 17 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 +TL NSCSPGDPL Sbjct: 1 MTLASNSCSPGDPL 14 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 63 CITLVPNSCSPGDPL 19 C+ + NSCSPGDPL Sbjct: 8 CLLEISNSCSPGDPL 22 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 +T + NSCSPGDPL Sbjct: 512 VTFLSNSCSPGDPL 525 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I L+ NSCSPGDPL Sbjct: 6 IYLISNSCSPGDPL 19 >SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) Length = 951 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+++R+S+ L + + LD+P + +D Sbjct: 166 LSGGQKQRISLARALYADKDLYLLDDPLSAVD 197 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 TL NSCSPGDPL Sbjct: 5 TLASNSCSPGDPL 17 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I +V NSCSPGDPL Sbjct: 5 IVVVSNSCSPGDPL 18 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I +V NSCSPGDPL Sbjct: 9 IPMVSNSCSPGDPL 22 >SB_44626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+++R+++ + N V LD+P + +D Sbjct: 4 LSGGQKQRVNLARAVYFNADVYLLDDPLSAVD 35 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 21 VDPPGCRNSARGLCRYRT 74 VDPPGCRNS G R T Sbjct: 16 VDPPGCRNSIEGCNRNLT 33 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I ++ NSCSPGDPL Sbjct: 3 IVIISNSCSPGDPL 16 >SB_32173| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-34) Length = 375 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 181 HHISRPHIHRTGWKKFKDNIAKLKWRLSIGSAHSHPWSFRSWEKLLT 321 H I RP HRT + + + W S A HP + SW+++ T Sbjct: 135 HAILRPLHHRTLSQCAFRTLISIPWIFSALIAALHPIQYHSWQEVYT 181 >SB_23783| Best HMM Match : ABC_tran (HMM E-Value=6.7e-07) Length = 210 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+++R+++ + N V LD+P + +D Sbjct: 102 LSGGQKQRVNLARAVYFNADVYLLDDPLSAVD 133 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 72 SCTCITLVPNSCSPGDPL 19 S T ++ NSCSPGDPL Sbjct: 11 STTSAPVISNSCSPGDPL 28 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -3 Query: 75 MSCTCITL-VPNSCSPGDPL 19 M+C T+ V NSCSPGDPL Sbjct: 1 MTCDIPTVTVSNSCSPGDPL 20 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 63 CITLVPNSCSPGDPL 19 C L NSCSPGDPL Sbjct: 4 CEPLASNSCSPGDPL 18 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 129 RDALRDSILSLPTR-SQLIMSCTCITLVPNSCSPGDPL 19 + A D LS + S+ I+ C NSCSPGDPL Sbjct: 2 KPAWNDPTLSRKLQYSEHIIKSRCSCQSSNSCSPGDPL 39 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 78 IMSCTCITLVPNSCSPGDPL 19 ++S I NSCSPGDPL Sbjct: 8 LISANIIVYTSNSCSPGDPL 27 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 96 PTRSQLIMSCTCITLVPNSCSPGDPL 19 P SQ+ NSCSPGDPL Sbjct: 66 PPSSQVFSQSPLSRFTSNSCSPGDPL 91 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 593 LSGGERKRLSIGLELLNNPPVIFLDEPTTGLD 688 LSGG+R R+S+ + + + LD+P + +D Sbjct: 582 LSGGQRARVSLARAVYADADIYLLDDPLSAVD 613 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 266 SGQLTAILGPSGAGKSSLLNILAG 337 +G L I GP G+GKS+LL + G Sbjct: 484 AGDLVIITGPVGSGKSTLLMTIQG 507 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 67 YLHNPRAEFLQPGGST 20 YLH EFLQPGGST Sbjct: 7 YLHPVYIEFLQPGGST 22 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 475 DGRRPEARVRGGERDKSRCGGRNNSAVETRQSQEHSHRETVGRGEKT 615 D R + R R +RDK R R+ + R H R+ R EKT Sbjct: 397 DKDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKT 443 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 120 LRDSILSLPTRSQLIMSCTCITLVPNSCSPGDPL 19 +RD + ++ S + + + I+ NSCSPGDPL Sbjct: 1 MRDIVANIQATSYFLRNSSNIS--SNSCSPGDPL 32 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 + L+ NSCSPGDPL Sbjct: 35 LDLISNSCSPGDPL 48 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 58 NPRAEFLQPGGST 20 +PR EFLQPGGST Sbjct: 39 DPRIEFLQPGGST 51 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 9 LVSNSCSPGDPL 20 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I V NSCSPGDPL Sbjct: 16 IAFVSNSCSPGDPL 29 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 69 CTCITLVPNSCSPGDPL 19 C L NSCSPGDPL Sbjct: 12 CQMEVLASNSCSPGDPL 28 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 5 LVSNSCSPGDPL 16 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 84 QLIMSCTCITLVPNSCSPGDPL 19 +L + + + L NSCSPGDPL Sbjct: 78 KLAVDASNLLLTSNSCSPGDPL 99 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 63 CITLVPNSCSPGDPL 19 C ++ NSCSPGDPL Sbjct: 4 CWSVTSNSCSPGDPL 18 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 75 MSCTCITLVPNSCSPGDPL 19 MS + + V NSCSPGDPL Sbjct: 1 MSTSKMLRVSNSCSPGDPL 19 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 78 IMSCTCITLVPNSCSPGDPL 19 I+S + + NSCSPGDPL Sbjct: 60 IISAETMVIESNSCSPGDPL 79 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 ++V NSCSPGDPL Sbjct: 346 SIVSNSCSPGDPL 358 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 L+ NSCSPGDPL Sbjct: 17 LISNSCSPGDPL 28 >SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 672 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 236 ILRSLNGDFRSGQLTAILGPSGAGKSSL 319 +++ L + SG+ I+G +GAGKS+L Sbjct: 437 VIKKLTFEINSGEKIGIVGRTGAGKSTL 464 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 63 CITLVPNSCSPGDPL 19 C+ NSCSPGDPL Sbjct: 29 CMRKTSNSCSPGDPL 43 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 84 QLIMSCTCITLVPNSCSPGDPL 19 QL+ + ++ NSCSPGDPL Sbjct: 109 QLVRAKNQKEIISNSCSPGDPL 130 >SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) Length = 842 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 137 PALVMHSAIPFFLYQLALSLSCPVPA*PSCRIPAARGIHCSRAP 6 P + S +P Y L +CP A R+ + RGI CSR P Sbjct: 91 PRSIWCSRVPTTQY---LVFACPHHAVSGVRVSSPRGIWCSRVP 131 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 75 MSCTCITLVPNSCSPGDPL 19 +S C+ L NSCSPGDPL Sbjct: 4 LSSLCVFL-SNSCSPGDPL 21 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 IT NSCSPGDPL Sbjct: 35 ITSTSNSCSPGDPL 48 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 L+ NSCSPGDPL Sbjct: 24 LISNSCSPGDPL 35 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 57 TLVPNSCSPGDPL 19 T++ NSCSPGDPL Sbjct: 18 TVLSNSCSPGDPL 30 >SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -2 Query: 106 SFSTNSLSA-YHVLYLHNPRAEFLQPGGST 20 + +TN++ A YH H + EFLQPGGST Sbjct: 33 TMATNTVFARYHG---HQSKIEFLQPGGST 59 >SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 67 YLHNPRAEFLQPGGST 20 +L +P EFLQPGGST Sbjct: 13 FLRDPIIEFLQPGGST 28 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 8/67 (11%) Frame = +1 Query: 463 GGNVDGRRP-EARVRGGERDKSRCG-------GRNNSAVETRQSQEHSHRETVGRGEKTI 618 GG+VD A GGE+DKS+ G R + + +S +++V G + + Sbjct: 62 GGDVDSSLALHAVPLGGEKDKSQIGDELGSITDRISKVLNEYESMYDDDKDSVREGNRIL 121 Query: 619 IYWPGAA 639 + W G A Sbjct: 122 VVWLGRA 128 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 L+ NSCSPGDPL Sbjct: 40 LISNSCSPGDPL 51 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 193 RPHIHRTGWKKFKDNIAKLKWRLSIGSAHSHPWSFRSWEKLLTEYFSGIQG*RVDRP 363 R + R W +F + + HP ++ SW + E++ + G R +RP Sbjct: 4011 RRKVFRGNWDQFIVKTNTFRRPIRARYIRVHPVTWYSWASMRVEFYGCVTGPRCNRP 4067 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 L+ NSCSPGDPL Sbjct: 70 LISNSCSPGDPL 81 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 +T NSCSPGDPL Sbjct: 18 LTFTSNSCSPGDPL 31 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 4/19 (21%) Frame = -3 Query: 63 CITL----VPNSCSPGDPL 19 C+TL V NSCSPGDPL Sbjct: 78 CLTLTQRIVSNSCSPGDPL 96 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 60 ITLVPNSCSPGDPL 19 I L NSCSPGDPL Sbjct: 9 IMLASNSCSPGDPL 22 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 54 LVPNSCSPGDPL 19 L+ NSCSPGDPL Sbjct: 21 LISNSCSPGDPL 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,401,574 Number of Sequences: 59808 Number of extensions: 612130 Number of successful extensions: 3626 Number of sequences better than 10.0: 177 Number of HSP's better than 10.0 without gapping: 3367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3609 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -