BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0496 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 24 4.3 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 7.5 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 608 VKFARQETDVAKKAREKSYETITQRVTAE 694 V+FAR + + E YET+ Q+ +AE Sbjct: 145 VEFARDYPEYFARVEEPLYETLKQQWSAE 173 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 644 KAREKSYETITQRVTAEPWYDAFWVNPILIKL 739 KA +++ + +T R+ +P + FW +P+L +L Sbjct: 323 KACDETMQRVT-RLHQDPHRNIFWWSPLLARL 353 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,252 Number of Sequences: 2352 Number of extensions: 14946 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -