BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0495 (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) 54 5e-08 SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) 29 1.2 SB_53793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_45652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 >SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) Length = 80 Score = 54.0 bits (124), Expect = 5e-08 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = +1 Query: 184 IAEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV 363 ++ + +GTVKWFN + GYGFI + +D+FVH AI + +S+ +G+AV F Sbjct: 12 MSNRQNGTVKWFNDEKGYGFIT-PQSGDDLFVHFKAIQSD----GFKSLKEGQAVTFVAT 66 Query: 364 AGEKGFEAAGV 396 G+KG +A V Sbjct: 67 RGQKGMQAEEV 77 >SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) Length = 581 Score = 29.5 bits (63), Expect = 1.2 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +2 Query: 215 GSTSRVDMVSSTGMTPRKMCLCIRLPSPVTTHVRLCARSATERRWSLPWLPGRKALKQLV 394 G++S + VSST +P + +C L P + LC TE R +P LP L+ Sbjct: 440 GTSSSIWDVSSTPRSPTRTPVCYALMIPFGHMLSLC--MDTEGRLRVPLLPTHGFAYALL 497 Query: 395 LLVP 406 +L P Sbjct: 498 ILGP 501 >SB_53793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 187 AEKVSGTVKWFNVKSGYGFINRNDTKEDVFVH 282 AEK G V ++K +GFI R D ++F H Sbjct: 201 AEKYQGVVS--SMKESFGFIERADKVSEIFFH 230 >SB_45652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 184 IAEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGD 336 +A+ + + VKSGY + DTK +V Q A P+ R+ GD Sbjct: 60 MADGYTAFFSFSRVKSGYSVFSGKDTKAEVPSLQAAQHLPEPKGRKRTTGD 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.132 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,143,707 Number of Sequences: 59808 Number of extensions: 175240 Number of successful extensions: 337 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -