BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0493 (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 31 1.3 SB_54814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_11808| Best HMM Match : Glycos_transf_1 (HMM E-Value=0.0021) 29 4.0 SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 5.3 SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_54277| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_36705| Best HMM Match : RRF (HMM E-Value=0.26) 29 5.3 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 28 7.0 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_11830| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_5215| Best HMM Match : DUF745 (HMM E-Value=1.6) 28 9.2 SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/77 (24%), Positives = 38/77 (49%) Frame = +2 Query: 191 SRSEKXXXXXXDNKVDQNIKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKGKEK 370 + E+ + K + ++KL E + EK+ Q+AKK++ + E +K +EK Sbjct: 276 TEEEEKQKEEAERKKQEKLEKLAKKKEELKERKRQEKLEQKAKKKEKERQEREKEKEREK 335 Query: 371 SILFPEEKQSFQDFEKE 421 + E+++ + EKE Sbjct: 336 ERIQQEKEKQKERREKE 352 >SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 293 VEKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKELF 427 + K I + K K LLE +V + K IL EE+ F++ +E+F Sbjct: 61 IPKCITESVKLKDLLEELKVAREKCHEILVKEEQDLFKERREEIF 105 >SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1055 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -2 Query: 358 FFHFCVLK*RFLLFSPLYNFFNNIGICCRFGKN*QLFYILVNFIIISCVVRF--FTSTFV 185 FF CVL FLLF+P+ F+N C + N + ++I+ ++ F FT Sbjct: 693 FFTICVLC--FLLFNPVSLIFSNFMDCSQLADNNARNFF--SYIVAVALLHFCNFTQLTS 748 Query: 184 WMRNCL 167 WM+ L Sbjct: 749 WMKTSL 754 >SB_54814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Frame = +3 Query: 492 GKFILISTATLFILTTLWINTYPFLDE--DSAVYELIPNP-KWFLLFCAVWGLFFIGGLM 662 G F ++ST + +T +P +DE ++ + ++ N + FL FC G F I L+ Sbjct: 246 GAFAIVSTLLVLDITA---ENFPTVDEVNENGIETMLANMWREFLTFC---GTFIIVALL 299 Query: 663 SFTLYHIYPYL 695 FT + ++ Y+ Sbjct: 300 WFTHHSLFHYI 310 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 269 EPAADPNIVEKI-IQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKELF 427 E AAD +VEK ++ K+QK + KK KEK + E ++ ++ +F Sbjct: 232 EEAADEILVEKTEVKEKKQQKRKFSFSNKKKNKEKEMDVSESEEKGEEMAPGMF 285 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 308 QRAKKQKPLLENTEVKK--GKEKSILFPEEKQSFQDFEKE 421 + K Q P L E+ K G+E + L PEEKQ F D +E Sbjct: 213 ESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAEE 252 >SB_11808| Best HMM Match : Glycos_transf_1 (HMM E-Value=0.0021) Length = 496 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 239 QNIKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTE 349 + I K +V+ P DPN+ E K+QK LEN + Sbjct: 205 EGILKKIVIIPPGLDPNVFEIGEDFDKRQKAFLENVQ 241 >SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 336 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/56 (23%), Positives = 28/56 (50%) Frame = +3 Query: 507 ISTATLFILTTLWINTYPFLDEDSAVYELIPNPKWFLLFCAVWGLFFIGGLMSFTL 674 ++ A+++ ++ + +N Y + + + EL + L VW + FIG + F L Sbjct: 109 LALASIYTMSLISVNRYFCIVKPAKYQELFKKRRTVLYILGVWTIAFIGSIPPFFL 164 >SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 299 KIIQRAKKQKPLLENTEVKKGKEKSIL 379 K I+R K+Q LEN+ VK GK+K L Sbjct: 5 KTIKRLKQQIASLENSNVKMGKQKKRL 31 >SB_54277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 525 FILTTLW-INTYPFLDEDSAVYELIPNPKWFL 617 F LTT + I Y +L+ED + NP+WF+ Sbjct: 43 FALTTSFEIGVYTYLNEDCTRESMYRNPQWFV 74 >SB_36705| Best HMM Match : RRF (HMM E-Value=0.26) Length = 397 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 525 FILTTLW-INTYPFLDEDSAVYELIPNPKWFL 617 F LTT + I Y +L+ED + NP+WF+ Sbjct: 47 FALTTSFEIGVYTYLNEDCTRESMYRNPQWFV 78 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = +3 Query: 414 KKNCFVAELHNYIKKYMYMDIPDAVVGKFILISTATLFILTTLWINTYPFLDEDSAVYEL 593 +KN + AE+ KY Y I DAV+ I S TLF I + + + A++ Sbjct: 401 RKNLYAAEMEELRSKYKYFRILDAVLA--IFGSDITLFASFGRDITVFENVKCEKAIFRS 458 Query: 594 IPNPK 608 + K Sbjct: 459 VKREK 463 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 287 WDLLQVRKELATFLYSGQLYYH 222 WD+ QVR+EL +Y L+ H Sbjct: 202 WDIKQVREELGAQVYHNMLFIH 223 >SB_11830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 247 YILVNFIIISCVVRFFTSTFVWMR 176 Y++ F +IS FF + FVW+R Sbjct: 39 YLIAQFFLISQSFLFFVARFVWLR 62 >SB_5215| Best HMM Match : DUF745 (HMM E-Value=1.6) Length = 171 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = -2 Query: 670 VKDIRPPMKNSPQTAQNSRNHFGFGINS*TAESSSKNGYVFIQRVVKINRVAVEININFP 491 +K I N+P Q S++ INS AE+++ + + + VK N + +E + Sbjct: 103 IKQITGLEPNTPVITQKSKDILARLINSGAAEATTNINKLMMGQGVKANAIRIEDLVRKM 162 Query: 490 TTASGMSI 467 SG+ + Sbjct: 163 NVGSGLRL 170 >SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 513 TATLFILTTLWINTYPFLDEDSAVYELIPNPKW 611 T LFI+ + +P +DE V+++ P P+W Sbjct: 885 TVNLFIMPYNYPTLFPLIDELVKVHKMKPVPRW 917 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,681,171 Number of Sequences: 59808 Number of extensions: 399588 Number of successful extensions: 894 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -