BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0493 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17310.2 68418.m02028 UTP--glucose-1-phosphate uridylyltransf... 31 0.61 At5g17310.1 68418.m02027 UTP--glucose-1-phosphate uridylyltransf... 31 0.61 At3g03250.1 68416.m00321 UTP--glucose-1-phosphate uridylyltransf... 31 0.61 At1g74340.1 68414.m08611 dolichol phosphate-mannose biosynthesis... 30 1.4 At1g09060.2 68414.m01011 transcription factor jumonji (jmjC) dom... 29 2.5 At1g09060.1 68414.m01010 transcription factor jumonji (jmjC) dom... 29 2.5 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 29 3.3 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 29 3.3 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 4.3 At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protei... 28 5.7 At3g32910.1 68416.m04167 hypothetical protein similar to At2g152... 28 7.5 At1g20670.1 68414.m02589 DNA-binding bromodomain-containing prot... 28 7.5 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 27 9.9 At2g42760.1 68415.m05295 expressed protein 27 9.9 At2g21770.1 68415.m02588 cellulose synthase, catalytic subunit, ... 27 9.9 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 27 9.9 >At5g17310.2 68418.m02028 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 470 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 474 IPDAVVGKFILISTATLFILTTLWIN---TYPFLDEDSAVYELIPNPK 608 +PD V +F I +F LW+N ++ D+ E+IPNPK Sbjct: 276 VPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKKLVEADALKMEIIPNPK 323 >At5g17310.1 68418.m02027 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 390 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 474 IPDAVVGKFILISTATLFILTTLWIN---TYPFLDEDSAVYELIPNPK 608 +PD V +F I +F LW+N ++ D+ E+IPNPK Sbjct: 196 VPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKKLVEADALKMEIIPNPK 243 >At3g03250.1 68416.m00321 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 469 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 474 IPDAVVGKFILISTATLFILTTLWIN---TYPFLDEDSAVYELIPNPK 608 +PD V +F I +F LW+N ++ D+ E+IPNPK Sbjct: 275 VPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKKLVEADALKMEIIPNPK 322 >At1g74340.1 68414.m08611 dolichol phosphate-mannose biosynthesis regulatory protein-related similar to dolichol phosphate-mannose biosynthesis regulatory protein SP:Q9Z324 from [Mus musculus] Length = 80 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +3 Query: 468 MDIPDAVVGKFILISTATLFILTTLWINTYPFLDEDSAVYE 590 M++ D VG + + ++F T W+ PF+D D +++ Sbjct: 1 MELADRAVGLLLSSISLSIFTYYTFWVIILPFVDSDHFIHK 41 >At1g09060.2 68414.m01011 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 930 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 296 EKIIQRAKKQKPLLENTEVKKGKEKSILFPEEK 394 E +R +K KP+ E + K + +S+L PE+K Sbjct: 667 ETTFERVRKTKPVPEEPDQKMSENESLLSPEQK 699 >At1g09060.1 68414.m01010 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 930 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 296 EKIIQRAKKQKPLLENTEVKKGKEKSILFPEEK 394 E +R +K KP+ E + K + +S+L PE+K Sbjct: 667 ETTFERVRKTKPVPEEPDQKMSENESLLSPEQK 699 >At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +2 Query: 266 SEPAADPNIVEKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFE 415 SE + VEK ++ ++ Q+ +++N + G + + L E+KQ D E Sbjct: 186 SEKPRSDSKVEKKLEESETQEEIVKNHKCNSGSKDNSLISEQKQEENDKE 235 >At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +2 Query: 266 SEPAADPNIVEKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFE 415 SE + VEK ++ ++ Q+ +++N + G + + L E+KQ D E Sbjct: 186 SEKPRSDSKVEKKLEESETQEEIVKNHKCNSGSKDNSLISEQKQEENDKE 235 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 643 NSPQTAQNSRNHFGFGINS*TAESSSKNGY 554 +SP+ ++S NH G INS +E S+ Y Sbjct: 146 SSPEAIEDSDNHVGIDINSIISEDSANASY 175 >At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protein similar to SP|Q05022 rRNA biogenesis protein RRP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00575: S1 RNA binding domain Length = 1838 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -1 Query: 209 SFFHFYFCMDEELLDLQTSNVS 144 SF YF MDE++ DLQ+S+++ Sbjct: 748 SFVQEYFLMDEKISDLQSSDIT 769 >At3g32910.1 68416.m04167 hypothetical protein similar to At2g15200, At2g04970, At1g32830, At2g14140, At4g03990 Length = 377 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/35 (31%), Positives = 24/35 (68%) Frame = +2 Query: 305 IQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQD 409 ++R KK+K +++ + KGK+K ++ +++ SF D Sbjct: 121 VKRKKKEKWWIKDNQTLKGKQKKDVWIDKEMSFID 155 >At1g20670.1 68414.m02589 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 652 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 314 AKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKEL 424 A++Q+P + N +++ LFP KQ F F +L Sbjct: 586 ARQQQPNVSNEATPVSQQQGSLFPYPKQEFHRFPPDL 622 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 245 IKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKG 361 +K L + + DPN +E + QRA K L+ N E+K+G Sbjct: 1090 LKILECTNHLSTDPNCLENL-QRADAIKQLIPNLELKEG 1127 >At2g42760.1 68415.m05295 expressed protein Length = 267 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 Query: 296 EKIIQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQD 409 EK QR KK+K N +KGK S L EE + F D Sbjct: 125 EKEEQRKKKKKK--SNVRTRKGKSMSDLEYEELKGFMD 160 >At2g21770.1 68415.m02588 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit, Arabidopsis thaliana (Ath-A) Length = 1088 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 528 ILTTLWINTYPFLDEDSAVYEL 593 ILT LW+ PF+ +D V E+ Sbjct: 1060 ILTLLWVRVNPFVSKDGPVLEI 1081 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +2 Query: 272 PAADPNIVEKIIQRAKKQKPLLENTEV----KKGKEKSILFPEEKQSFQDFEKELF 427 P + +K ++ KP+ +++ V K GK K ++ P+E Q DFE+ LF Sbjct: 510 PEGETEESDKSKLKSSSTKPVADSSGVSEPLKSGKTK-VVAPKETQDNDDFERTLF 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,065,101 Number of Sequences: 28952 Number of extensions: 299946 Number of successful extensions: 800 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -