BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0492 (511 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 190 8e-49 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.10 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.42 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 2.2 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 2.2 SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) 29 2.2 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 3.9 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 3.9 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 28 3.9 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 3.9 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 5.1 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 5.1 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 5.1 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) 27 6.8 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 190 bits (462), Expect = 8e-49 Identities = 91/148 (61%), Positives = 103/148 (69%) Frame = +2 Query: 68 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQT 247 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGHQT Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQT 59 Query: 248 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXX 427 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 60 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQRRF 119 Query: 428 XXXXXXXXXXXXXXXXXRGHIIEKIPEL 511 RGH IEKI E+ Sbjct: 120 AVCSALAASALPALIMARGHRIEKIAEV 147 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 33.9 bits (74), Expect = 0.078 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 341 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 228 Y +HP T+ YH H R H Q+P + H + Q P Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTHRYQYQHP 268 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 341 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQ 234 Y +HP T+ YHH H + ++ Q+P + H + Q Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRYHQQ 447 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 332 HPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQP 231 HP T+ YH H R H Q+P + H + P Sbjct: 406 HPQVTHRYHQHPQLTH-RYHHQHPQVIHRYHQHP 438 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 341 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 249 Y +HP T+ YH R Q+P + H Sbjct: 242 YHQHPQVTHRYHQQHPQVTHRYQYQHPQVTH 272 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.10 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 243 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 362 YVHHDTCYRRHPDRTYEYHHHGH 294 Y HH CY RH + Y HH H Sbjct: 25 YCHHRYCYYRHHHYCW-YRHHYH 46 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.42 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 273 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 365 TYVHHDTCYRRHPDRTYEYHHHGHA 291 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 2.2 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 368 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 264 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 245 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 361 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2325 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 164 DLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARI 289 D+ NDV ++++ + PY + H T E TG+ +A++ Sbjct: 2034 DVTNDVTINVTDVNEAPYDIRLVPSHVTVKEDIRTGQCIAQV 2075 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.3 bits (60), Expect = 3.9 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 263 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 391 G GR + R P GGG R G +G M GG P W R Sbjct: 271 GQGRGMGRGP---GGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHH 300 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 135 GRGLAAPCTVSLFSEYTDTKGRATDRLI 52 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 158 RPDLVNDVHVSMSKNSRQPYC-VSKEAGHQTSAESWGTGRAV 280 RP +SM K R+PY + +E GH+ S T R V Sbjct: 156 RPGCDTHEKISMEKRKREPYLELIRETGHERQRRSVSTERNV 197 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 362 YVHHDTCYRRHPDRTYEYHHHGH 294 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 5.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHH 300 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 5.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHHGH 294 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 344 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 249 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 362 YVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQ 267 Y HH + +H + +HHH H H Q Sbjct: 257 YHHHHHHHHQHNHHQHHHHHHHHHHNHHHHHQ 288 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 5.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 260 WGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 391 WG G+ + R GGG R G +G M GG P W R Sbjct: 24 WGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 365 TYVHHDTCYRRHPDRTYEYHHHGHA 291 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) Length = 772 Score = 27.5 bits (58), Expect = 6.8 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +2 Query: 203 SRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF-GNMCRGGRMFAP 373 SRQPY + GH G G P +RGG + G G G G R AP Sbjct: 110 SRQPYGPGRGRGHPNGRPMQGRGMQ----PGIRGGMMPQQGPGVRPGFPPAGSRQMAP 163 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,333,061 Number of Sequences: 59808 Number of extensions: 291117 Number of successful extensions: 923 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -